SecReT6
Protein ID: 431802760
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14130
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3105792..3106508 [+]
Producthypothetical protein
NoteTssL
UniProt IDL0FM28
KEGG IDppuh:B479_14130
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-54, Aligned region: 19..221
Protein Sequence: 238 a.a.     [Download]
>gi|431802760|ref|YP_007229663.1| hypothetical protein B479_14130 [Pseudomonas putida HB3267]
MTEAVLQQGAVAAANDKPTLKDLVQDFISMALIVRRGRQVTSVPAFEASVERFFANLEREARAANYSAEQ
VKDTQYALCAFLDESVLRASDNQLRQHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3105792-3106508 Pseudomonas putida HB3267, complete genome
ATGACCGAAGCCGTATTGCAACAGGGCGCCGTCGCGGCCGCCAACGACAAACCGACGCTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCCCTGATCGTGCGGCGTGGTCGTCAGGTCACCTCGGTGCCGGCCTTCGA
AGCCAGCGTGGAACGCTTCTTCGCCAACCTGGAACGCGAAGCACGCGCTGCCAACTACAGCGCCGAACAG
GTCAAGGACACCCAGTACGCGCTGTGTGCCTTCCTCGACGAGAGCGTGCTGCGCGCGAGCGACAACCAGC
TGCGCCAGCACTTCGAGCTGCAGCCGCTGCAGTTCCGCTACTTCGGCGTGCACCTGGCGGGTGAAGGCTT
CTTCGAGAAGGTCGATGCGCTGCGTGCCGACGTCAAGCAGAACATCGATGTGCTCGAGGTCTACCACCTG
TGCCTGGCCTTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAGAAAGACCAGCTGCGCTACCTGGCCAATA
CCCTGGGCCAGGATATTGCCCGCTACCGCAAGGCGCCCAAAGCACTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCACGAGGTGCCGCTGTGGGTTTACCTGGCGCTGATCGCGCTGGTCTGC
GTCGCCGTGTACCTGACGCTGGACTGGTTGCTGGACAAGGACGTCGCCGCCCTTTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA
 Primer design