SecReT6
Protein ID: 431802763
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14145
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3111244..3113739 [+]
ProductOmpA/MotB domain-containing protein
NoteTssM
UniProt IDL0FL34
KEGG IDppuh:B479_14145
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-67, Aligned region: 83..112
ImcF-related_N [PF14331], Evalue: 3.20E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 9.50E-16, Aligned region: 716..811
IcmF-related [PF06761], Evalue: 2.00E-08, Aligned region: 95..132
IcmF-related [PF06761], Evalue: 2.00E-08, Aligned region: 323..323
IcmF-related [PF06761], Evalue: 2.00E-08, Aligned region: 507..640
Protein Sequence: 831 a.a.     [Download]
>gi|431802763|ref|YP_007229666.1| OmpA/MotB domain-containing protein [Pseudomonas putida HB3267]
MNKIKYYCLRYQPYLLGVAFFLAIFLVWAIGCALGFASLHSLLAGIGVFLLLSAGYVLLLYRGAGQHHNL
EGLLRDDADQAVLNATPADREEVSLLRERLLQSIERLRSNTPRGTSAKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSAEDQDRVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARG
EVMGKTFSHKGYAQADWGQRFGKAMDELTGYWQQVASQHLVQQDIQVTRQNNAAYRFPLELAALKPRLQQ
FVDSLLRANPYQNAEMLRGFYFTAALQADEALWGSHGQHVAERFALEHAEGTATAVSQPAPLFINSLFRK
VIIPDQHLVALYTSNTRERRRKAGWVAATGLAALVLCSLWGWSYLNNRATLASIAGELAQAKADDQAARG
QYAAWHSLDRLRFWAEHYYQQHREQGVPLGMRLGLYQGHEVEPLLRSRYFATLQNVMLKPTADNLTRTLY
LLTTIKVYQRNTRELQPVSGVDSVEAEALPHDNRAQSIADFGKAALDTYVMLSPARRENADPAFLKAHLP
DYWYPAIARHTGKSMAAAASEAGGNQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRSIETITLESDTLFAFGRADFQSLKSEGQRQLSAIASKLLNTPDIGKIIISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDLQQPRAQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3111244-3113739 Pseudomonas putida HB3267, complete genome
ATGAACAAGATCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGAGTGGCGTTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCTGCGCCCTGGGCTTCGCCTCGCTGCATAGCCTGCTGGCCGGTATCGG
CGTGTTTCTGCTGCTGTCGGCGGGCTATGTACTGCTGCTGTACCGCGGCGCCGGCCAGCACCACAACCTC
GAAGGGTTGCTGCGCGACGATGCCGACCAGGCGGTACTCAACGCCACCCCCGCCGACCGCGAAGAAGTAA
GCCTGCTGCGCGAACGCCTGCTGCAGAGCATCGAGCGCCTGCGCAGCAACACACCTCGCGGCACCTCGGC
CAAGGACGCGCTGTACGCCCTGCCCTGGTACCTGGTGATCGGTCAGCCGGCCGCCGGCAAGAGCACGATG
ATCCTGCAGTCGGGCCTGAACTTCCCCTATGCCGAACGCGAAGGCGCACGGGTTGCGGGGCTTGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCCGAAGCCGTGCTGCTGGATACCGCCGGGCGCTACATGAACAG
CCCCGAAGAAGCCGGCAAGTGGCGCGGCTTCCTGCAGCTGTTGCGCCAGCATCGCCAACGCCGCCCTCTC
AACGGCTTGATCGTCAGCGTCAGCATCGCCGACATCCTGCATGGCTCGGCCGAGGACCAGGACCGCGTGG
CCAAGCGCCTGCGTGAACGGATCCAGGAAAGCTGCGCGCTGCTGGAAGTGCGCCTGCCGATCTACCTGGT
GTTCACCAAGTGCGACCTGATCCCCGGCTTCACCCCGTTCTATCGCCAGCTTGACGACGCCGCGCGTGGC
GAGGTGATGGGCAAGACCTTCTCGCACAAGGGTTACGCGCAGGCCGACTGGGGCCAGCGCTTCGGCAAGG
CGATGGACGAACTGACCGGTTACTGGCAGCAGGTGGCGAGCCAGCACCTGGTGCAGCAGGACATTCAGGT
CACCCGGCAGAACAACGCTGCCTACCGCTTCCCGCTGGAGCTGGCCGCGCTCAAGCCGCGCCTGCAGCAG
TTCGTCGACAGCCTGTTGCGTGCCAACCCGTACCAGAATGCCGAAATGCTGCGCGGGTTCTATTTCACTG
CCGCACTGCAGGCCGACGAAGCCCTGTGGGGCAGCCACGGCCAGCATGTGGCCGAACGCTTCGCCCTCGA
ACATGCCGAAGGCACCGCCACTGCCGTCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAG
GTGATCATCCCTGACCAGCACCTGGTGGCGCTGTACACCAGCAACACGCGGGAGCGCCGGCGCAAGGCGG
GCTGGGTTGCCGCCACCGGCCTGGCAGCCCTGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCACCCTGGCCAGCATCGCCGGCGAACTGGCCCAGGCCAAGGCCGACGACCAAGCTGCCCGCGGC
CAGTACGCCGCCTGGCATAGCCTTGACCGCTTGCGCTTCTGGGCCGAGCACTACTATCAGCAGCACCGCG
AACAGGGCGTGCCGCTGGGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGCTGCTGCGCAG
CCGTTACTTCGCCACGCTGCAGAACGTGATGCTCAAGCCCACGGCAGACAACCTGACCCGCACCCTGTAC
CTGCTGACCACGATCAAGGTGTACCAGCGCAACACCCGCGAACTGCAGCCTGTGAGCGGCGTGGACAGCG
TCGAGGCCGAGGCGCTGCCACATGACAACCGCGCGCAGTCGATCGCCGACTTCGGCAAGGCAGCGCTGGA
TACCTACGTGATGCTCTCGCCGGCCCGACGCGAAAACGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCC
GACTACTGGTACCCGGCCATCGCTCGCCATACCGGCAAGAGCATGGCCGCGGCCGCCAGCGAGGCCGGCG
GCAACCAGGACTACCTGTACGCCAGCCGCCAGATCACCTTCTACAGCGACCAGATTCGTGAGCCGGATGT
GCCGCGTATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAATTACATCGACAGCCTGCGCGCCCAG
TCGCTGCGTTCGATCGAGACCATCACGCTGGAGTCCGACACCCTGTTCGCTTTCGGCCGGGCCGACTTCC
AGAGCCTGAAGAGCGAGGGCCAGCGCCAGCTGAGCGCGATCGCCAGCAAACTGCTGAACACGCCCGACAT
CGGCAAGATCATCATTTCCGGCCACGCCGACCAGCTCGGCGACAGCCAAGGCAACCTGCAGGTTTCGAAA
CAGCGGGCGCAGACCATTCGCACCTACCTGGTCGGCAAGGGCGTACCTGCCGAACTGGTGGTCGCCCAGG
GCGAAGGCAGCCGCAAGCCGCTGGTCAACTGCGACCTGCAGCAACCGCGGGCGCAACTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTACGCGGGCTCAACTGA
 Primer design