SecReT6
Protein ID: 431802764
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14150
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3113883..3114401 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDL0FID7
KEGG IDppuh:B479_14150
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.20E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|431802764|ref|YP_007229667.1| Hcp1 family type VI secretion system effector [Pseudomonas putida HB3267]
MAFDAYIQIDGIPGEVLDAKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFIAGGNQNGEDKAVSDLPVEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3113883-3114401 Pseudomonas putida HB3267, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCGGGCGAAGTACTGGATGCAAAGCACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCCACCTCGGCTACCGCCAGCTCCTCGGGCGG
TGCGTCGTCCGAGCGTGTTGCCCTGAGCGACTTCAAGATCCGCAAGGCGGTCGACAAGGCTTCGGCCAAG
CTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGTG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTCGTGGTCTCCTCGGTGCGCTTCATCGCCGGTGG
CAACCAGAACGGTGAAGACAAGGCTGTGAGCGACCTGCCGGTCGAAGAAATCAGCTTCAACTTCGCCCGC
ATCAAAACTACCTACACCCAGCAGAACCGCACCGACGGCCAGGCTGGCGGCAACATCGTCGGCGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTGA
 Primer design