SecReT6
Protein ID: 431802765
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14155
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3114497..3115594 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDL0FM32
KEGG IDppuh:B479_14155
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.70E-20, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 1.70E-20, Aligned region: 200..214
ImpA-rel_N [PF06812], Evalue: 1.70E-20, Aligned region: 241..257
Protein Sequence: 365 a.a.     [Download]
>gi|431802765|ref|YP_007229668.1| ImpA family type VI secretion-associated protein [Pseudomonas putida HB3267]
MPEILNDLSLATLTAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVVNLSAQGL
AQQSKDLMLVAWLSEGLAQREHFEGITFGLRLTEQVLEAFWDTLYPTLEDGLDERAARLSWLKTTLTDIA
GGLPITQGQNFGVLRYDESRYVENLALQNPKAMETALNEGKINAEIFQRSVALSDTEHLRTKALQIAASL
EACKALQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPATVAAAEPEATVAPTSEAGEPM
NTPVQATTPAPMRTTPLTRDEAFTMLAGIAQFFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDSNV
VDNIRDVLGTREPRS
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3114497-3115594 Pseudomonas putida HB3267, complete genome
ATGCCTGAAATCCTCAATGACCTTTCGCTGGCAACGCTGACCGCACCCATCGAGGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCGCGCCGGGCAGACCCTGACTACCTGACCCA
GGGCGACTGGCAAACCGACCTGAAGACCGCCGACTGGGAGCAGGTGGTCAACCTGTCGGCCCAAGGGCTG
GCGCAGCAAAGCAAGGACCTGATGCTGGTAGCCTGGCTCAGCGAAGGGTTGGCCCAGCGTGAACATTTCG
AAGGCATCACCTTTGGCCTTCGGCTGACCGAACAGGTACTGGAAGCATTCTGGGACACGCTGTACCCAAC
ACTCGAAGATGGCCTGGACGAACGCGCTGCGCGGCTGTCCTGGCTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTACCCAAGGGCAGAATTTTGGCGTGTTGCGCTATGACGAATCACGCTACGTAGAAA
ACCTTGCCTTGCAGAACCCCAAGGCAATGGAGACCGCGCTGAACGAAGGCAAGATCAACGCCGAAATCTT
CCAGCGCTCGGTGGCGCTCAGCGACACCGAACACCTGCGCACCAAGGCCCTGCAGATCGCCGCCAGCCTG
GAGGCCTGCAAAGCCCTGCAAGCCAGTGCCGACCGCCTGTTCGGCCATGAGGCGCCCAGCTTTGCCAGCC
TTGCCGACATGCTGTCGCGCGCCAGCCAGCTGGCTGAAAAACTGCTCAAGGACCGCGGTGTCGAACTGCA
CCCCGCCACTGTGGCAGCGGCAGAACCCGAAGCCACTGTTGCCCCCACCAGCGAAGCAGGTGAACCGATG
AACACACCCGTCCAGGCCACCACGCCTGCGCCGATGCGCACGACGCCCCTGACCCGCGACGAAGCCTTCA
CCATGCTTGCGGGTATCGCCCAGTTCTTCAAGCAGAGCGAACCGCAGAGCCCGGTGCCTTACCTGATCGA
ACGCGCCATCAAGTGGGGCAACATGCCGCTGGAAGGCTGGCTGAGCGATGTGATCAAGGACAGCAACGTG
GTGGACAACATTCGCGACGTGCTGGGCACCCGCGAGCCAAGATCCTGA
 Primer design