SecReT6
Protein ID: 431803402
SecReT6 ID716
T6SS typei1
Gene symbol-
Locus tagB479_17350
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3811081..3814653 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDL0FM39
KEGG IDppuh:B479_17350
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.70E-88, Aligned region: 512..818
ImcF-related_N [PF14331], Evalue: 7.20E-64, Aligned region: 204..466
DUF1215 [PF06744], Evalue: 2.70E-32, Aligned region: 915..1036
Protein Sequence: 1190 a.a.     [Download]
>gi|431803402|ref|YP_007230305.1| ImcF domain-containing protein [Pseudomonas putida HB3267]
MPLVARIGLAMPLLLGLGAALMLVAIWWLGPQWVWRGQQPLASVAHRGLASLALVLVPLLCWLVVLRRRF
RRLQAERKQAVDAELDNVLPFVQAQEKALDQGLARYLDNAGGRRALYRLPWYLVVGDQQAGKTSFIDRTE
QSFSLTRIDKAQARGRQAQVLAYPIGWWVSNDAVIIDPPGAFVRQESLAGSSAEESDTSKAPPATSARLW
EHMLGWLVRNRSQRALNGLLLVVDLPALLHGTPEQRVALAHVLRTRLYEVSSQSGSRLPLYVVLAKFDLL
DGFDQLYAGLPAAMRENMLGFTFKLDAVGTFDAWLDEYGDHYDRLIRQLFEQVVDRLDVLAGAPLRVRLF
SLHAQLIGLRPILLAFLKETLASDRFTTPALVRGVYWSSVLQQGDMLNAFVREAAQPYKTEFPLREGKAQ
GQALVYFIQHAFRRVIYQEAGLAGDNIKVARSKRRLLWVGSAVGVLAFSVAIASWQRYFDINGAKAANVL
AKSREYSHHEVDQRLDPTGRNLLEPLDQIRDAVSVFGNYRAAWPGVSDLGLYQGRAIGPRVDEAYLSLLS
RRFLPALASGVIDAMDAAPPGSEQQMAALRVYRMLEDRQSRRPEWVEDWMARQWQQKFPGQGQLQGDLMR
HLQYALAYADTDLPQYRQRIAEVQQVLRKVPLPERVYASLKQQAGEQLNAGLDLRHQVGPAFDVVYHSSP
GFRQGEGVLIAPMLTAKGFKEYFEPRSQRFADMAMIDQWALGERGQLDYSDADREALGERLRNLYSADFI
DSWRRALNAFSVADFRDLDHGVAILGQLTGPAAPLHRLLDTVRDNTSLSSAVVAEAPGEVEALRPTSGRP
DQQQAWAIQRAFAGLSAMLQATGEKPSYYDETLGAIAAVHDYAKAVQDSPDRGKAALQAVHQRFSMTGQD
PIGTLQRVATGLPEPINQQVRKMADQAAQVLNVEALRELERRWDAEVYSFFQQRLAGRYPFVVKAPDASL
DDFEAFFGPKGRLQQFHDQYLKVFLRDNLEALQAGQQGQSLIRSDVLEQLERADRIRETFFDQRGNLSVQ
FSIEPLGLSANQRTSLLDLDGQLIPYTHGPSQITGIVWPNTLGQQVRSNLTLLRQNGNSSSLEYRGPWSM
FRLLSRGSLNGRTATSVDLSFRTGDGVMRYRLNAQKAFNPITQEPFKGFQLPRGLLQKSPKLGPTTQAGL
 
Nucleotide Sequence: 3573 bp     [Download]
>gi|431799958|ref|NC_019905.1|:c3814653-3811081 Pseudomonas putida HB3267, complete genome
TTGCCCCTGGTGGCCCGTATCGGCCTGGCCATGCCGCTGCTGCTCGGGTTGGGTGCCGCATTGATGCTGG
TTGCAATCTGGTGGCTCGGCCCGCAATGGGTCTGGCGCGGGCAGCAGCCGCTGGCTAGCGTGGCGCATCG
CGGTTTGGCCAGCCTGGCGCTGGTGTTGGTGCCGCTACTCTGCTGGCTTGTGGTGCTGCGCAGGCGTTTT
CGCCGTTTGCAGGCCGAACGCAAGCAGGCGGTGGACGCTGAACTGGACAACGTGTTGCCTTTCGTCCAGG
CACAGGAGAAAGCCTTGGACCAAGGGCTGGCACGCTATCTGGACAATGCGGGTGGCAGGCGTGCCTTGTA
CCGACTGCCGTGGTATCTGGTGGTGGGCGACCAACAGGCCGGCAAGACCAGCTTCATCGACCGTACCGAA
CAGAGTTTTTCCCTGACCCGCATCGACAAGGCACAAGCGCGAGGCAGGCAAGCGCAGGTGCTGGCTTATC
CGATAGGCTGGTGGGTCAGTAACGATGCGGTGATCATCGACCCGCCGGGCGCTTTCGTCCGTCAGGAATC
GTTGGCAGGTTCATCAGCCGAGGAGTCAGACACGTCGAAAGCGCCACCCGCCACCTCGGCCAGGTTGTGG
GAACACATGCTGGGCTGGCTGGTACGTAACCGAAGCCAGAGAGCACTAAATGGCTTGCTGTTGGTCGTTG
ACCTGCCTGCGCTACTGCATGGCACGCCTGAGCAACGTGTCGCCTTGGCGCATGTGCTACGCACGCGGCT
GTATGAAGTGAGCAGTCAGTCGGGCTCGCGCCTGCCGCTGTATGTGGTACTGGCCAAATTCGATCTGCTG
GACGGTTTCGACCAGCTGTACGCTGGGCTTCCTGCCGCCATGCGGGAAAACATGCTGGGCTTCACCTTCA
AACTGGATGCGGTCGGCACGTTCGATGCCTGGCTGGATGAATATGGCGATCATTACGATCGGTTGATAAG
GCAATTGTTTGAACAGGTAGTGGACCGGCTCGATGTATTGGCCGGTGCGCCGTTGCGAGTTCGCTTGTTT
TCGTTGCATGCCCAGTTGATCGGGCTGCGTCCGATACTGTTGGCCTTCCTGAAAGAAACCCTCGCAAGTG
ACCGTTTCACCACGCCTGCCTTGGTACGTGGCGTGTACTGGTCTTCGGTCTTGCAGCAGGGCGACATGCT
CAATGCGTTCGTGCGTGAGGCGGCACAGCCGTACAAGACCGAGTTTCCGCTGCGTGAAGGCAAGGCGCAG
GGGCAGGCGCTGGTCTACTTCATTCAGCACGCCTTCCGGCGAGTCATCTACCAGGAGGCCGGCCTTGCCG
GGGACAACATCAAGGTAGCGCGCAGCAAACGTCGGTTGCTCTGGGTGGGGTCTGCAGTAGGCGTGCTGGC
CTTCAGTGTCGCCATCGCCAGTTGGCAACGCTACTTTGACATCAATGGCGCCAAGGCCGCCAACGTGCTC
GCCAAGAGCAGAGAGTACAGTCATCACGAAGTGGACCAGCGTCTGGACCCCACCGGGCGCAACCTGCTGG
AACCGCTGGACCAGATACGCGATGCCGTGTCGGTGTTTGGCAACTATCGTGCCGCGTGGCCAGGTGTTTC
CGACCTTGGCTTGTATCAGGGGCGCGCCATTGGCCCTCGCGTCGATGAGGCCTACCTGAGCTTGCTCTCC
AGGCGCTTCCTGCCAGCCTTGGCCAGCGGTGTGATCGATGCCATGGACGCTGCGCCGCCGGGCAGTGAAC
AGCAGATGGCTGCGCTTCGGGTTTATCGAATGCTGGAGGACCGCCAGAGCCGCCGCCCCGAATGGGTCGA
GGACTGGATGGCCCGCCAGTGGCAACAGAAGTTCCCCGGGCAGGGGCAATTGCAAGGCGACCTCATGCGG
CACCTGCAGTATGCCTTGGCCTATGCCGATACCGATCTGCCGCAGTATCGCCAGCGTATTGCAGAGGTGC
AGCAGGTCCTGCGCAAGGTACCTTTGCCAGAGCGGGTGTACGCGAGCCTGAAACAGCAGGCTGGAGAGCA
GTTGAATGCCGGCCTGGACCTGCGTCATCAGGTGGGGCCAGCGTTCGATGTGGTGTATCACTCCTCACCC
GGCTTCAGGCAGGGGGAGGGTGTCCTGATAGCGCCAATGCTCACCGCCAAGGGCTTCAAAGAGTACTTCG
AACCACGTAGTCAGCGGTTTGCAGATATGGCCATGATCGACCAGTGGGCACTTGGAGAGCGTGGCCAGCT
CGATTACTCGGATGCCGACCGGGAGGCGCTGGGCGAACGGCTGCGTAACTTGTACAGCGCCGATTTCATT
GACAGTTGGCGTCGTGCCTTGAATGCCTTTTCGGTGGCTGACTTCCGCGACCTGGATCATGGCGTAGCGA
TCCTGGGGCAGTTGACCGGGCCAGCAGCGCCCCTGCATCGGTTGCTGGACACAGTGAGGGACAACACTTC
GCTTTCATCAGCCGTTGTCGCTGAGGCACCCGGGGAGGTCGAAGCGTTGCGACCGACAAGTGGCAGGCCT
GATCAACAACAGGCCTGGGCCATTCAGCGGGCCTTTGCCGGGCTGAGTGCCATGCTGCAGGCAACCGGTG
AGAAACCCAGCTACTACGATGAAACTCTTGGTGCCATCGCGGCCGTGCACGACTATGCCAAGGCGGTGCA
AGACAGCCCCGACCGAGGCAAGGCCGCGCTGCAGGCCGTGCATCAGCGATTCTCGATGACAGGGCAAGAC
CCCATCGGCACCCTGCAGCGGGTGGCCACCGGCTTACCGGAACCGATCAACCAACAGGTCAGAAAGATGG
CCGATCAAGCAGCACAGGTGCTGAATGTCGAAGCCCTGCGCGAATTGGAGCGACGCTGGGACGCCGAGGT
ATACAGCTTCTTCCAGCAGCGCCTGGCAGGGCGCTACCCCTTTGTCGTGAAGGCTCCCGACGCCTCGCTG
GACGACTTTGAGGCCTTCTTCGGGCCGAAGGGGCGGCTGCAGCAGTTCCATGATCAATACCTGAAGGTCT
TCCTGAGGGATAACCTCGAAGCCCTGCAGGCCGGCCAGCAGGGGCAGTCGCTGATCCGCAGTGATGTGCT
CGAACAGCTGGAGCGGGCAGACCGTATCCGCGAGACCTTCTTTGATCAGCGCGGCAACCTGAGTGTGCAG
TTCAGCATCGAGCCGTTGGGCCTGAGTGCCAACCAGCGTACAAGCTTGCTGGACCTGGACGGCCAATTGA
TTCCCTACACCCATGGCCCGAGCCAGATCACCGGTATCGTCTGGCCCAATACCTTGGGGCAGCAGGTGCG
CAGTAACCTGACCTTGCTTCGGCAGAACGGGAACAGCAGCAGCCTTGAGTACCGTGGCCCCTGGTCGATG
TTCCGCTTGCTCAGCCGTGGCTCGCTCAATGGGCGCACGGCGACCAGCGTGGACCTGAGCTTCAGGACCG
GCGATGGCGTGATGCGCTACAGGCTTAACGCGCAGAAAGCCTTCAACCCTATTACGCAAGAGCCTTTCAA
AGGTTTCCAGTTGCCACGAGGGTTGTTGCAGAAGTCGCCCAAGCTGGGGCCGACCACGCAGGCCGGCTTG
TGA
 Primer design