SecReT6
Protein ID: 431925333
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0124
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]120517..122034 [-]
Producttranscriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains
NoteSfa2
UniProt IDL0GG46
KEGG IDpsh:Psest_0124
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 7.80E-71, Aligned region: 199..366
Sigma54_activ_2 [PF14532], Evalue: 9.50E-25, Aligned region: 200..370
HTH_8 [PF02954], Evalue: 2.00E-14, Aligned region: 458..498
AAA_5 [PF07728], Evalue: 1.60E-07, Aligned region: 222..341
GAF_3 [PF13492], Evalue: 3.50E-06, Aligned region: 31..152
GAF_2 [PF13185], Evalue: 3.60E-06, Aligned region: 29..176
GAF_2 [PF13185], Evalue: 3.60E-06, Aligned region: 262..285
HTH_30 [PF13556], Evalue: 8.50E-06, Aligned region: 454..468
HTH_30 [PF13556], Evalue: 8.50E-06, Aligned region: 472..498
HTH_28 [PF13518], Evalue: 0.003, Aligned region: 472..495
AAA_2 [PF07724], Evalue: 0.0093, Aligned region: 221..321
Protein Sequence: 505 a.a.     [Download]
>gi|431925333|ref|YP_007238367.1| transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Pseudomonas stutzeri RCH2]
MSAMFNQVPQPLRYAEALLGRFAGLARAANADSLLGGLVETAAQLSDCQLSQLYLLDATHTRLTLCAEWH
NGLLQPREATSLPSDYDGEQLLQYCLCQNQTLCLSELDSSLHASGFLPDSPKPWRSLLCLPLQDEQQRVA
GLLLTASTESRELHGFSGSLSQLGAFGLTQLHLLQRLRAPGSTTPPAAPVSPCASGYGLIGDSPRMRAVY
QLIGKVLHSPVNVLLTGETGTGKELVARAIHDCGFRRSKPFVVQNCASLPEQLLESELFGYRKGAFTGAD
RDRSGLLDAANGGTLFLDEIGDMPLLLQAKLLRVLQEGEVRPLGSTETHKVDVRIVAATHRDLRSQVENG
LFREDLFYRLSHFPIELPPLRERDEDILRLARHFADKACAFLQRDLCRWSDAALERLAGYAFPGNVRELK
GLVERAVLLCEGGELLPEHLNLHVEASLDSSLNLRERMERVERSLLMDCLRKNGGNQSQAARELGLPRRT
LLYRMERLNISPADL
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c122034-120517 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGTCCGCGATGTTCAATCAGGTGCCGCAACCACTGCGCTATGCCGAGGCCCTGCTCGGTCGCTTCGCCG
GTCTGGCACGCGCGGCGAATGCCGACAGCCTGCTCGGTGGGCTGGTGGAAACCGCAGCGCAGCTAAGCGA
TTGCCAGCTCAGCCAGCTCTATCTGCTGGACGCCACCCACACTCGCCTGACGCTCTGCGCTGAATGGCAC
AACGGCCTGCTGCAGCCACGCGAAGCCACCAGTCTGCCGAGTGATTACGACGGCGAGCAGCTGCTGCAGT
ATTGTCTGTGCCAGAACCAGACCCTCTGCCTCAGCGAACTGGACAGCAGCCTGCATGCTTCGGGTTTCCT
GCCGGATAGCCCGAAACCGTGGCGCAGCCTGCTCTGCCTGCCGCTGCAGGACGAGCAGCAGCGCGTCGCC
GGCCTGCTGCTCACGGCCAGTACCGAGTCGCGCGAGCTGCACGGCTTCAGCGGTTCGCTGTCCCAGCTCG
GCGCTTTCGGCCTCACCCAGCTGCATCTGCTCCAACGCCTGCGCGCGCCCGGCAGCACCACGCCACCTGC
CGCGCCAGTCAGCCCCTGCGCCAGCGGTTACGGCCTGATCGGCGACAGCCCACGCATGCGCGCGGTCTAC
CAGTTGATCGGCAAGGTGCTGCACAGCCCGGTCAACGTGCTGCTCACGGGAGAAACAGGCACTGGCAAGG
AACTGGTGGCGCGTGCCATTCACGATTGCGGGTTTCGCCGCAGCAAGCCCTTCGTCGTACAGAACTGCGC
CTCGCTGCCTGAGCAGCTGTTGGAAAGCGAACTGTTCGGCTACCGCAAGGGCGCCTTCACCGGTGCCGAC
CGCGACCGCAGCGGCCTGCTTGATGCGGCGAACGGCGGCACGCTGTTTCTCGACGAGATCGGTGACATGC
CGCTGCTGCTGCAGGCCAAGCTGTTGCGCGTGCTGCAGGAAGGCGAAGTGCGCCCGCTGGGCTCCACCGA
AACCCACAAGGTCGACGTGCGCATCGTCGCCGCCACCCACCGCGACCTGCGCAGCCAGGTGGAGAACGGC
CTGTTTCGCGAGGATCTGTTCTACCGCCTCTCGCACTTCCCCATCGAACTGCCGCCGCTGCGCGAGCGCG
ACGAGGACATCCTGCGCCTGGCCCGGCATTTCGCCGACAAGGCCTGCGCGTTCCTGCAGCGCGATCTGTG
TCGCTGGTCCGACGCCGCGCTCGAACGTCTGGCAGGCTACGCCTTCCCCGGCAACGTGCGGGAATTGAAG
GGCTTGGTGGAGCGTGCAGTGCTGCTCTGCGAGGGCGGTGAGCTGCTGCCGGAACACTTAAATCTGCATG
TGGAAGCAAGCCTGGACAGCAGCCTGAACCTGCGCGAACGCATGGAGCGGGTCGAACGCAGCCTGCTCAT
GGATTGCCTGCGCAAGAACGGCGGCAACCAGAGCCAGGCTGCCCGCGAACTCGGCCTGCCGCGGCGCACC
CTGCTGTATCGCATGGAACGGCTGAATATCAGCCCGGCCGATCTCTAA
 Primer design