SecReT6
Protein ID: 431929311
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4246
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4428515..4432054 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDL0GTK4
KEGG IDpsh:Psest_4246
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.60E-78, Aligned region: 502..793
ImcF-related_N [PF14331], Evalue: 7.00E-71, Aligned region: 197..453
DUF1215 [PF06744], Evalue: 2.80E-37, Aligned region: 914..1038
AAA_33 [PF13671], Evalue: 4.00E-05, Aligned region: 135..267
AAA_33 [PF13671], Evalue: 4.00E-05, Aligned region: 470..490
DUF4131 [PF13567], Evalue: 0.0084, Aligned region: 15..109
DUF4131 [PF13567], Evalue: 0.0084, Aligned region: 450..470
Protein Sequence: 1179 a.a.     [Download]
>gi|431929311|ref|YP_007242345.1| type VI secretion protein IcmF [Pseudomonas stutzeri RCH2]
MKTFFGKLGAVLRRTWVWSLLLVLLLAVVVWFVGPLLAVDDYRFWEASTARLLSISVLFLGWGLAMVFTS
WRASARRKRDAEDQDVQEQLRRDGLIGEEQQELRHRFKQALRTLKTSSLYRGRSEKWRSELPWYLLIGPQ
GSGKTSLLDFSGLDFPLNRSEQQRLTKDVSGTRYADWYFADHAVLIDTAGRYLTQPDAAVDGSVWDTLLG
LLRKRRARPLNGVLVNLPVDQLQGGSELELENLARQTRQRLHEIHQRLNVDVPVYLVLSKADRILGFDDF
FEQLSREESDQVLGASFRKEQNGSDAQVVRQEFEELLRRLNSQVILRMHQERDTQRRGRILDFPHQLGQI
GERLSLFIELAFAGNRYQRASQLRGFYLTSAPQLRETLDPLTAGIGRQLGLSSSALPTFRSGRARFINQL
LSRVIFPEAELAGLDQREVRRIDWGQRALYAGAFGCLLLFGAAWALNFSGNHERLEQLRDIAQRLGSERK
TIEAGDEALRTLKALDASYAATQVFPPKDEVSWLRRGGLYQGEAVDPTLHEAYRRDLENLLLPRVARQLE
AQIRANLNDREQLLGSLRAYLMLNLAERREAAFLKDWLAADWSLRHSGNAVAQQGLNTHFARLLEESFAA
YQLNDNLVAKARAQLRSESLAAVVYRMLRDQARNLPDYRLNTQLGPQASLFVGGDYTIPGFYTQRGYQKL
FVAQGADLVSEILRDNWVLGEGDSLSAKDLGRLLVEMEQLYFRDYAAHWSEAIAQLNILPAGSAAQGAAQ
LAGLTAANSPLLQLLLEVRENTRFAGLAEATAGAGELAEAAQGAGGKLGKAAKLATAAAEQAQAALLKNT
PDTARKTLERRFAPLHQLLDENGAAGPELSASLQALDALQLQLASLAHASAPEQAAFEMAKARMGGQRDA
INQLRSSAARLPQPVGKWLGLLAEDSWSLVLTDAYHYLNQRYRNELYASYRGSLRERYPFSAHSASDVAL
ADFREFFKAQGLADSFFERYLKPFVSGSAGQYQLRRVDGRGLPLSEHFLAQMSRAQTIRRSFFAENPNEP
QILFKLEPYSLDSSLGRADFRFGNQQLEYRHGPIVQTAFRWPAEADDGRTSLVVEELGGRRVGIEKNTGP
WSLFRLIDLMQVDYHSGRDVLMLKADLGGLRANYLLHAQRSPNPFDLALLRGFKLPATL
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|431925209|ref|NC_019936.1|:4428515-4432054 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGAAGACGTTCTTTGGCAAGCTCGGCGCCGTACTGCGCCGGACCTGGGTCTGGAGCCTGCTGCTGGTCC
TGCTGCTGGCAGTCGTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTCGACGACTACCGCTTCTGGGAAGC
GTCGACCGCACGCCTGCTGAGCATCAGCGTGCTGTTTCTCGGCTGGGGCCTGGCCATGGTCTTCACCAGC
TGGCGCGCCAGCGCGCGCAGGAAGCGCGACGCGGAAGACCAGGACGTTCAGGAGCAGCTGCGCCGCGACG
GCCTGATCGGCGAAGAGCAACAGGAGTTGCGCCATCGTTTCAAGCAGGCGCTACGCACCCTGAAGACCTC
CAGCCTCTATCGCGGGCGCAGCGAGAAATGGCGCAGCGAGCTGCCCTGGTACCTGTTGATCGGTCCGCAG
GGCAGCGGCAAGACCAGCCTGCTGGACTTCTCCGGGCTGGATTTCCCACTCAACCGCAGCGAACAGCAGC
GCCTGACCAAGGACGTCTCCGGCACCCGCTATGCCGACTGGTACTTCGCCGATCATGCCGTGCTGATCGA
CACCGCCGGCCGCTACTTGACCCAGCCCGATGCAGCTGTCGACGGCAGCGTCTGGGACACCCTGCTCGGC
CTGCTGCGCAAGCGCCGCGCGCGTCCGCTCAACGGCGTGCTGGTCAACCTGCCGGTGGACCAGCTGCAAG
GCGGCAGTGAACTGGAGCTGGAGAACCTGGCCCGCCAGACCCGTCAGCGCCTGCACGAGATCCATCAGCG
TCTGAACGTGGACGTGCCGGTCTACCTAGTGCTGAGCAAGGCCGACCGGATTCTCGGTTTCGACGACTTC
TTCGAGCAGCTGTCCCGCGAGGAAAGCGACCAGGTGCTCGGCGCGAGTTTCCGCAAGGAGCAGAACGGCA
GCGATGCGCAGGTGGTGCGCCAGGAGTTCGAGGAACTGCTGCGCCGGCTGAACAGCCAGGTGATCCTGCG
CATGCATCAAGAGCGCGATACACAGCGCCGTGGCCGGATCCTCGACTTCCCGCATCAGCTGGGGCAGATC
GGCGAGCGCCTGAGCCTGTTCATCGAACTCGCGTTTGCCGGCAACCGCTACCAGCGTGCCAGCCAGCTGC
GTGGCTTCTACCTGACCAGCGCGCCGCAGCTACGCGAAACGCTCGACCCGCTCACCGCCGGCATCGGCCG
CCAGCTCGGCCTGTCCAGCAGTGCGCTGCCGACCTTCCGCAGCGGTCGTGCGCGCTTTATCAATCAGTTG
CTCAGCCGGGTGATTTTCCCCGAAGCCGAACTGGCCGGCCTCGACCAGCGCGAAGTGCGCCGCATCGACT
GGGGCCAGCGTGCCCTCTATGCCGGCGCCTTCGGCTGTCTGCTGCTGTTCGGCGCTGCCTGGGCTCTGAA
CTTCTCCGGCAACCATGAACGCCTGGAACAGCTGCGCGACATCGCCCAGCGACTCGGCAGCGAGCGCAAG
ACCATCGAGGCGGGAGACGAGGCACTGCGCACCCTCAAGGCTCTGGACGCGAGCTATGCGGCGACGCAGG
TGTTCCCGCCGAAAGACGAGGTGTCCTGGCTGCGCCGGGGCGGCCTGTATCAGGGCGAAGCGGTCGACCC
GACGCTGCACGAGGCCTACCGCCGCGATCTGGAGAACCTGCTGCTGCCACGTGTCGCCCGGCAGCTGGAA
GCGCAGATTCGCGCCAACCTGAACGACCGCGAGCAGCTGCTCGGCAGCCTGCGCGCCTATCTCATGCTCA
ACCTGGCCGAACGCCGTGAAGCGGCCTTCCTCAAGGACTGGCTGGCCGCCGACTGGTCGCTGCGCCATTC
GGGCAATGCCGTGGCGCAGCAGGGGCTCAACACACACTTTGCGCGGCTGCTGGAAGAATCCTTCGCTGCA
TACCAGCTGAACGACAATCTGGTGGCCAAGGCCCGCGCTCAGCTGCGCAGCGAATCGCTGGCGGCAGTGG
TGTACCGCATGCTGCGCGACCAGGCACGCAACCTTCCCGACTATCGGCTGAATACGCAGCTCGGCCCGCA
GGCATCCCTGTTCGTCGGCGGCGACTATACGATTCCCGGCTTCTACACCCAGCGCGGCTACCAAAAACTG
TTCGTCGCCCAGGGCGCCGATCTGGTCAGCGAGATCCTGCGCGACAACTGGGTACTGGGCGAAGGCGACA
GCCTCAGCGCCAAGGACCTCGGCCGTCTGCTGGTGGAAATGGAGCAGCTGTACTTCCGCGACTATGCCGC
GCACTGGAGCGAAGCGATCGCCCAACTGAACATCCTCCCCGCAGGTAGTGCGGCGCAGGGTGCCGCGCAG
CTCGCTGGGCTCACCGCCGCCAACTCACCGCTGCTGCAACTGCTGCTGGAAGTACGCGAGAACACCCGCT
TCGCCGGTCTGGCCGAAGCGACCGCCGGGGCTGGCGAGCTGGCCGAAGCGGCGCAAGGCGCCGGCGGCAA
GCTCGGCAAGGCGGCCAAGCTGGCCACCGCAGCTGCCGAGCAGGCCCAGGCAGCACTGCTGAAGAACACG
CCGGACACCGCGCGCAAGACCCTGGAGCGTCGCTTTGCACCGCTGCACCAGCTGCTCGACGAAAACGGCG
CGGCCGGCCCCGAGTTGAGTGCCAGTCTGCAGGCCCTCGACGCCCTGCAGCTGCAGCTGGCTTCCCTGGC
CCATGCCAGCGCACCGGAACAGGCCGCCTTCGAAATGGCCAAGGCACGCATGGGCGGCCAGCGCGACGCC
ATCAACCAGCTGCGCAGCAGCGCTGCACGCCTGCCACAACCGGTCGGCAAGTGGCTGGGGCTGCTGGCCG
AAGACAGCTGGTCGCTGGTGCTCACCGATGCCTACCACTACCTCAACCAGCGCTATCGCAACGAGCTCTA
CGCCAGCTACCGCGGCTCGCTGCGCGAGCGTTATCCGTTCAGCGCGCACAGCGCCAGCGACGTCGCCCTC
GCCGACTTCCGCGAGTTCTTCAAGGCCCAGGGCCTGGCGGACAGCTTTTTCGAGCGCTACCTCAAGCCCT
TCGTCAGCGGCAGCGCTGGCCAGTATCAACTGCGCCGGGTCGACGGTCGCGGCCTGCCGCTGTCCGAGCA
CTTTCTGGCGCAGATGAGCAGGGCGCAGACCATTCGCCGCAGCTTCTTCGCCGAGAACCCCAACGAGCCG
CAGATCCTGTTCAAGCTCGAGCCCTATTCGCTGGATTCGAGCCTCGGTCGCGCCGACTTCCGCTTCGGCA
ACCAGCAGCTGGAGTATCGCCACGGGCCGATCGTGCAGACTGCGTTCCGCTGGCCGGCCGAAGCCGACGA
CGGTCGCACCAGCCTGGTGGTGGAAGAACTCGGCGGCCGTCGTGTCGGTATCGAGAAGAACACCGGGCCC
TGGTCGCTGTTCCGCCTGATCGACCTGATGCAGGTCGACTACCACAGCGGCCGCGACGTGCTGATGCTCA
AGGCCGATCTCGGCGGCCTGCGCGCCAACTACCTGCTGCACGCGCAGCGCTCGCCGAATCCGTTCGACCT
CGCGCTGCTGCGCGGCTTCAAGCTGCCGGCGACGCTGTGA
 Primer design