SecReT6
Protein ID: 431929312
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4247
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4432054..4432785 [+]
Productserine/threonine protein phosphatase
NoteStp1
UniProt IDL0GRS3
KEGG IDpsh:Psest_4247
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 9.60E-16, Aligned region: 20..206
PP2C [PF00481], Evalue: 1.40E-13, Aligned region: 31..205
SpoIIE [PF07228], Evalue: 8.00E-10, Aligned region: 37..242
Protein Sequence: 243 a.a.     [Download]
>gi|431929312|ref|YP_007242346.1| serine/threonine protein phosphatase [Pseudomonas stutzeri RCH2]
MDATACSWRSAARTDTGKVRARNEDAFLDLPQAGLWAVADGMGGHQNGALASRLIIEQLADLSTTGDLPE
RLLALRRCLHELNRRLSQELTVTAERPDPVIGSTVVALLMEGDHAACIWAGDSRCYLWRSGRLYQLSRDH
SLLQQLIDEQQLSPEVAAKHPAAHALTRAIGASEKLELDILEFVVLPGDTLLLCSDGLYQSMSADALGAA
LSLPSTQLALERLFRQALKGPARDNLSAVVIRR
 
Nucleotide Sequence: 732 bp     [Download]
>gi|431925209|ref|NC_019936.1|:4432054-4432785 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGGACGCAACGGCATGCAGCTGGCGCAGCGCCGCGCGCACCGACACCGGCAAGGTGCGGGCGCGCAACG
AGGATGCCTTCCTCGATCTGCCGCAGGCCGGGCTCTGGGCCGTGGCGGACGGCATGGGCGGACACCAGAA
CGGTGCTCTGGCCAGTCGCCTGATCATCGAGCAGCTGGCCGATCTATCCACTACGGGCGATCTGCCTGAG
CGGCTGCTGGCGCTGCGGCGCTGCCTGCATGAGCTGAATCGCCGGCTCAGCCAGGAACTGACGGTCACCG
CCGAACGCCCCGATCCGGTGATCGGCAGCACCGTGGTCGCCCTGCTCATGGAGGGTGACCACGCCGCCTG
CATCTGGGCTGGCGACAGCCGCTGCTACCTGTGGCGCAGCGGCCGTCTCTATCAGCTGTCACGCGACCAC
TCGCTGTTGCAGCAACTGATCGACGAGCAGCAGCTCAGCCCCGAGGTTGCCGCCAAACATCCGGCCGCTC
ACGCGCTGACCCGCGCCATCGGCGCCAGCGAGAAGCTGGAGCTGGATATCCTCGAGTTCGTCGTGCTGCC
TGGCGACACGCTGCTGCTGTGCAGCGATGGGCTCTACCAGAGCATGTCCGCCGACGCGCTTGGCGCCGCC
CTCAGTCTGCCGTCCACGCAGTTGGCGCTGGAGCGGCTGTTTCGCCAGGCGCTCAAGGGCCCGGCGCGCG
ACAATCTCAGTGCCGTGGTGATCCGCCGATGA
 Primer design