SecReT6
Protein ID: 431929313
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4248
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4432782..4433753 [+]
Productserine/threonine protein kinase
NoteStk1
UniProt IDL0GSE6
KEGG IDpsh:Psest_4248
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 1.30E-33, Aligned region: 41..272
Pkinase_Tyr [PF07714], Evalue: 3.80E-22, Aligned region: 43..295
APH [PF01636], Evalue: 0.0055, Aligned region: 135..190
APH [PF01636], Evalue: 0.0055, Aligned region: 218..304
Protein Sequence: 323 a.a.     [Download]
>gi|431929313|ref|YP_007242347.1| serine/threonine protein kinase [Pseudomonas stutzeri RCH2]
MNAQPACDLTYFALASTAATPVPVVPKTPAGELPDVLGGRYRIERLLGVGGMGAVYRARDLLREQFGDPE
PYVALKTLSEDFAEYPDASALLYSEYALTTRLSHRHVVRLYNFEIDPSSQRAFITLELLKGPTLDQLLCE
RLQGMPWSELQGIALPLLEALTYSHSLGVLHGDLKPSNVMLADDGLRLFDYGLGQPLEGLLPGLPRLCRT
RFAAWTPRYAALELLDGGELTASADIYALACVLYELASGSHPYRRLSARQAKAMELDRTLQRPPQLPAHC
WPALRLALAFDEAQRSIDAAGLLHAFSRPAPNRWQRWFGHSHG
 
Nucleotide Sequence: 972 bp     [Download]
>gi|431925209|ref|NC_019936.1|:4432782-4433753 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGAATGCCCAGCCCGCCTGCGATCTCACCTATTTTGCGCTGGCGTCCACCGCGGCCACGCCGGTGCCGG
TGGTGCCGAAGACACCTGCCGGCGAGCTTCCGGACGTACTCGGCGGCCGCTATCGGATCGAGCGGCTGCT
CGGCGTCGGCGGAATGGGCGCGGTCTATCGAGCGCGTGACCTGCTGCGCGAACAGTTCGGCGATCCGGAA
CCCTACGTGGCGCTGAAGACGCTCAGCGAGGATTTCGCCGAATACCCCGATGCCAGCGCCCTGCTCTACA
GCGAATACGCACTGACCACGCGCCTCAGCCACCGCCATGTGGTGCGCCTGTACAACTTCGAGATCGACCC
AAGCAGCCAGCGCGCCTTCATCACCCTGGAGCTGCTCAAGGGGCCAACCCTCGACCAGCTGCTCTGCGAA
CGCCTACAGGGCATGCCTTGGAGCGAACTGCAGGGCATCGCGTTACCCCTGCTGGAAGCGCTGACCTACT
CCCATAGCTTGGGCGTACTGCATGGCGACCTGAAACCGAGCAACGTGATGCTCGCCGATGACGGCCTGCG
ACTGTTCGACTATGGCCTCGGCCAGCCGCTGGAAGGCCTGCTGCCCGGTCTGCCGCGCCTGTGCCGCACG
CGCTTCGCCGCCTGGACACCGCGTTATGCCGCGCTGGAACTGCTCGACGGTGGCGAGCTGACCGCCAGCG
CCGACATCTACGCACTGGCCTGCGTGCTCTATGAACTGGCCAGTGGCAGCCACCCTTATCGCCGGCTCAG
CGCCCGCCAGGCCAAGGCGATGGAGCTGGATCGCACCCTGCAACGGCCGCCGCAGCTGCCCGCGCATTGC
TGGCCGGCGCTGCGTCTGGCGCTGGCATTCGACGAAGCGCAGCGCAGCATCGATGCGGCGGGCCTGTTGC
ACGCCTTCAGCCGCCCCGCACCGAACCGTTGGCAGCGCTGGTTCGGCCACTCCCACGGATGA
 Primer design