SecReT6
Protein ID: 433657605
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1323
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1483370..1486759 [-]
ProductIcmF-related protein
NoteTssM
UniProt IDL0HVB9
KEGG IDvpb:VPBB_1323
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-57, Aligned region: 153..411
IcmF-related [PF06761], Evalue: 4.80E-48, Aligned region: 209..231
IcmF-related [PF06761], Evalue: 4.80E-48, Aligned region: 498..755
DUF1215 [PF06744], Evalue: 3.10E-30, Aligned region: 866..987
Protein Sequence: 1129 a.a.     [Download]
>gi|433657605|ref|YP_007274984.1| IcmF-related protein [Vibrio parahaemolyticus BB22OP]
MFKQKILRNPVVVSTIVALVLAAIFAAVYLFIFEDADKLYLWVGLGVITGFYFTFQLSLWLKKKNSSKVQ
RLETEEEALSMVIRPLLSNAGKKPIYLMVGNKGAGRRQFLFNSSAIKPMDRSRTAKNDFFEWYESDGAVY
VKPDQRLIFQEVSSSDASLWNTFIDEVIRHRPRKPFSGCLFFVDFEFMIVSEPEQKDYTMTALLQRLNSI
TEKTSSALPVYLMMTKLDKLDGFKEYVHSSSLKTRIEFLSIPLKEAKGVLTEYYLDSFHNLVKVLESNAL
DASANSTDISEKQAILAFPKQFELCQREISYVLERLCDTNNGVYSLDIREIFFCSSLQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFSRFLLDSQILPESDFAGENKTYLRMIQRQSHLAMLASVVLLAGGTYFF
VTTLDSNLRVINQLLNIDEKVQTEQEASFNQLLMSATRAIQPSYNAWLEGSRALDEEIVPLNISRLNEST
KLAYEALIKEVAQQLMPVIEQGYRFELTHNQHDVTATLPLLKGYLMLKDPTKRDIQFLRRQTLQTLTDLS
DKPDVVNQAMRYLDAYFRTQFSPVDINMDVVRATRRSLLANSNVDLVYAGILNQADAIDLGTLDLQRAVG
FEFNNVFNEPLDDNRLVIDKIYTSTGFSTFYRPRVDLMSKQVISDNWVLGLSNYVTPTKEEQESFKNQVR
KKYTDDYINYWRNALSELKIQSYSNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNVLISKVD
PKLAEVANSASEAVEEVVQPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETIAALSRVRTYMKDIADA
PDPQMAALAAAQHRMSSSEADPLIKLKQIAQKSPEPVRSWLLDVVKQSWSVMITESAKGIQTQWYSEIYT
KFKEIGLGKYPFDLTATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWVPKQVDGETMPLSSALLV
QLRNYNVIRDTLINKSTNRVYIPFSAKVLDLDSSAIRASLKISDTDINYYHGPSRIREMEWPPQNGDFNI
SITIQDVTDEGKQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESI
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|433656322|ref|NC_019955.1|:c1486759-1483370 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGTTCAAACAAAAAATACTAAGAAATCCAGTCGTGGTTTCTACCATAGTGGCTTTGGTATTAGCCGCGA
TATTTGCAGCGGTATATTTATTCATATTTGAAGACGCTGATAAGCTTTATCTATGGGTTGGTTTAGGAGT
TATTACTGGTTTTTATTTTACATTCCAGCTTTCCCTATGGCTTAAGAAAAAAAACAGCTCAAAAGTTCAA
CGTTTAGAGACGGAAGAAGAAGCTCTTTCAATGGTGATCCGCCCTCTTCTTTCTAATGCGGGCAAAAAGC
CAATCTATCTGATGGTTGGTAATAAAGGGGCCGGTCGACGTCAGTTTTTGTTTAATTCCAGCGCAATTAA
GCCGATGGACCGTTCTCGCACAGCAAAAAACGATTTCTTCGAATGGTATGAATCTGATGGTGCCGTTTAT
GTTAAGCCAGATCAACGCCTCATCTTCCAGGAAGTTTCAAGCAGTGATGCTTCTCTCTGGAATACTTTTA
TTGATGAGGTGATTCGTCATCGTCCGAGAAAACCGTTTTCAGGTTGCTTATTCTTTGTTGATTTCGAATT
TATGATTGTATCTGAGCCAGAGCAGAAAGATTACACCATGACAGCGCTATTGCAGCGTTTGAACTCTATC
ACTGAGAAGACTTCGTCTGCACTACCTGTTTATTTGATGATGACGAAACTCGACAAACTAGATGGCTTTA
AAGAATACGTTCACTCTAGTTCACTAAAAACACGTATTGAATTTCTGTCCATTCCATTGAAGGAAGCGAA
AGGTGTACTTACCGAATACTACCTAGATAGCTTCCATAATCTGGTAAAAGTGCTAGAAAGCAACGCTTTA
GACGCATCGGCAAACTCAACAGATATCAGCGAAAAGCAAGCCATCCTTGCCTTCCCAAAACAGTTTGAAC
TCTGTCAACGTGAAATCAGCTACGTGCTTGAACGTCTTTGCGATACAAACAATGGCGTTTACTCGTTGGA
TATTCGCGAAATCTTCTTCTGTTCTTCTTTGCAAGGTGGACGCAAGTACAACTTGTTAGCCAAAAGCTGC
AGTAATTACTTCAATTTACCAATTATCGCATCTGAGCACACGCAACTAACTGAAACACCGTACTTTTCTC
GCTTCTTGCTTGATTCTCAAATCCTCCCAGAGAGTGACTTCGCAGGCGAGAACAAGACTTACCTACGCAT
GATTCAGCGTCAAAGCCATTTGGCAATGCTGGCATCCGTTGTCTTATTGGCAGGCGGTACTTATTTTTTT
GTCACAACACTAGACAGTAACTTGCGTGTTATTAACCAATTGCTAAATATCGACGAAAAAGTTCAAACAG
AACAAGAAGCAAGCTTCAACCAGTTATTGATGAGTGCTACTCGTGCAATCCAACCCTCATACAATGCTTG
GTTAGAAGGATCACGAGCATTAGATGAAGAAATAGTACCGCTAAATATAAGCAGGTTAAATGAAAGTACA
AAATTAGCTTATGAAGCATTGATTAAAGAGGTTGCTCAACAACTTATGCCTGTTATTGAGCAAGGCTACC
GTTTTGAACTGACACACAACCAACATGATGTCACAGCAACGTTGCCGTTATTAAAAGGCTACTTGATGTT
GAAGGACCCGACCAAGCGAGATATTCAGTTTTTACGACGCCAAACATTGCAAACACTAACAGACTTGAGC
GATAAGCCGGATGTGGTAAATCAAGCTATGCGATACCTGGACGCCTACTTCCGCACTCAATTCTCACCTG
TAGATATCAACATGGATGTCGTTCGAGCAACTCGTCGATCATTGTTGGCAAATTCAAATGTGGATCTTGT
TTACGCAGGCATTTTAAACCAAGCAGATGCTATCGATCTTGGCACACTCGATCTACAACGTGCAGTTGGC
TTTGAATTTAACAACGTATTTAACGAGCCGTTAGATGACAACCGACTAGTAATCGATAAGATTTATACCT
CCACTGGCTTTAGTACCTTCTATCGCCCTCGCGTCGACTTGATGTCTAAACAAGTGATCAGTGATAACTG
GGTGCTAGGATTGTCCAACTATGTTACCCCAACCAAAGAAGAGCAAGAATCGTTTAAAAATCAAGTACGT
AAAAAGTACACAGATGATTATATCAACTACTGGCGCAACGCTCTCAGTGAGTTAAAAATTCAGAGTTATA
GCAATGTGGGTGATCTAACAAATGCTATCGACCTAATCTCTGGACCATCCTCACCAATGACGACTGTATT
AAAGCAAGTCTATGCAAATACTCAGTTTTCACCGGTAGGAGAAAAAAATGTACTCATCTCGAAAGTAGAC
CCAAAACTGGCAGAAGTGGCGAACTCTGCGTCAGAAGCGGTTGAAGAAGTGGTTCAGCCGGATTACTTGT
TGATGAAGCGTGTAGAACAAGCGTTCCATCTTCTAAATCAGCTTCAAGTAAGCGAGACTCCTAACTCCCC
TACTCCATGGGACGAAACTATCGCAGCTTTAAGCCGAGTTCGCACCTACATGAAAGATATTGCGGATGCT
CCCGATCCACAAATGGCAGCACTTGCAGCCGCTCAACACCGAATGAGCAGCTCTGAAGCCGATCCGCTAA
TTAAACTTAAACAGATTGCTCAGAAGTCACCAGAGCCAGTACGCAGTTGGTTACTTGATGTCGTAAAGCA
AAGCTGGTCGGTAATGATCACCGAATCAGCAAAAGGCATTCAAACCCAATGGTATAGTGAAATTTACACC
AAATTTAAAGAGATAGGACTTGGTAAATACCCATTTGATCTCACAGCAACAGAGGAGATTTCTATCGAAG
ACTTCGAACTGTTGTTTGCTTCAGGTGGATTGTTAGACACATTTATTCAGAAAAACTTCGCACCGTTCTA
CGATACCAACTTGTGGGTACCAAAACAGGTGGATGGTGAAACAATGCCACTATCTTCAGCCTTACTGGTG
CAATTGCGCAATTACAACGTTATCCGCGACACGCTGATCAATAAGAGTACTAACCGAGTTTATATTCCAT
TCAGTGCGAAAGTATTAGATCTTGACTCAAGTGCTATCAGAGCCAGTTTGAAAATCTCTGACACTGATAT
CAACTACTATCACGGTCCGAGCCGAATTCGTGAAATGGAGTGGCCACCGCAAAACGGCGACTTCAACATT
AGTATCACGATCCAAGATGTGACAGACGAAGGTAAACAACACGTTTTAAATAAGAGTGGTCAATGGGCGA
TATATAGATTGCTAGGTGATTCGACCCTGACAAACACTCATAACGGTAGCTTCGTTAGTGACATAAAAGT
ATCAGGGAGGGATTTGAGCCTCCGTATAACTCCCTTGACACAAAAAAACCCTTTCACTTTGGCTGAGTTG
TACAACTTTACGCTCCCAGAGTCGATTTGA
 Primer design