SecReT6
Protein ID: 433660102
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0932
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1048650..1050485 [-]
ProductVgrG protein
NoteTssI
UniProt IDL0I319
KEGG IDvpb:VPBB_A0932
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.00E-57, Aligned region: 30..335
Phage_base_V [PF04717], Evalue: 2.00E-24, Aligned region: 377..470
Protein Sequence: 611 a.a.     [Download]
>gi|433660102|ref|YP_007300961.1| VgrG protein [Vibrio parahaemolyticus BB22OP]
MKKASQDNNFIRISSPFGKDALILNLFEYREGISELFSLRAKAYFNDQKNELNEIVGKEVTISVENSSRV
SKSPRFFHGIVSAAKLEGQRVMNSHNGENYKNIEIIVEPKVKFAAYRNNCKIFQKKNIKDIISEVLSEHG
VAFKFELKNTYPQYSYKVQYEESDLAFVQRLLAEEGLSFCFSHSKSSHVLDIFDDVSFYKPSPEFMVDFD
TGSSESSHISAWNETQVLTTKSSQKSGFNMLKPASQPKNVAAGDTALFTVPASEYFEYLGETESDDQYSL
RNTHAIESLQQNVYLCSGEASCRTFSVGKCFKFKKHEDKSRVGKEYVLASVTIFASVFNQTGLGGTASQG
VRVAFTCVDSKTILRPAVTYPKPQIKGLQTAIVTGNKDGEVYVDKHGRIKVQFHWDRLGKYDVNSSCWIR
VAQSVAGNGWGAVFHPRVGQEVIVEFVNGDPDQPIVTGALYNGSQLPPYSLPEKSSQSGFKSRSVQKGNA
NFNELRFEDKPGEEHIYLHAEKLFQMLVEDCVDIVVENNKVEKVTNDVTQDVGKNAMLKVGENYTSDTGK
VLSLNAGKSIEIKVGGASIQMSSSGEINIKGNKISINGSAIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1050485-1048650 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGAAAAAAGCAAGTCAAGACAACAACTTTATCCGTATTTCTTCTCCGTTTGGAAAAGATGCTCTTATTC
TCAATTTGTTCGAATATAGAGAAGGGATCTCGGAGCTTTTTTCATTGCGTGCTAAAGCTTATTTTAATGA
TCAAAAAAATGAGCTCAATGAAATCGTGGGTAAAGAAGTAACGATTTCAGTAGAAAATAGTAGTCGTGTT
TCTAAAAGTCCGCGTTTTTTCCATGGCATTGTCTCTGCTGCAAAGCTCGAAGGCCAGAGAGTGATGAATT
CTCATAATGGAGAAAACTACAAAAATATTGAAATTATTGTTGAACCGAAAGTTAAGTTCGCAGCGTACAG
AAATAATTGTAAGATCTTTCAGAAGAAAAATATAAAAGACATTATTTCCGAAGTGCTTTCAGAGCATGGT
GTTGCATTTAAATTTGAACTAAAAAATACGTATCCCCAATATTCCTACAAAGTTCAGTATGAAGAATCTG
ATCTTGCTTTTGTTCAGCGCCTCCTAGCCGAAGAAGGGCTCTCTTTTTGCTTTAGTCACTCTAAATCATC
CCATGTCCTAGATATTTTTGATGATGTAAGTTTTTACAAACCCAGTCCTGAGTTTATGGTCGATTTCGAT
ACAGGCAGTTCAGAGTCGAGTCACATTTCTGCTTGGAACGAAACACAAGTTTTAACGACTAAATCAAGCC
AGAAGTCTGGCTTCAATATGCTAAAACCAGCCTCACAACCCAAAAACGTAGCTGCTGGTGATACTGCACT
GTTTACCGTACCTGCGAGTGAGTATTTTGAGTATCTGGGTGAAACAGAAAGTGACGATCAGTACTCGCTT
CGAAACACTCACGCAATTGAATCCCTTCAACAGAACGTTTATCTATGTAGCGGAGAGGCGAGTTGTCGAA
CCTTTTCTGTGGGTAAATGTTTTAAGTTCAAAAAACACGAAGATAAATCGCGAGTAGGAAAAGAATATGT
CTTGGCCTCTGTGACGATTTTTGCTTCTGTGTTTAATCAAACTGGTCTGGGTGGCACCGCTTCTCAAGGT
GTTCGTGTTGCGTTTACTTGTGTGGACTCTAAAACCATTTTAAGGCCAGCGGTTACTTACCCTAAACCGC
AAATTAAAGGTCTTCAAACAGCCATTGTGACTGGTAATAAAGACGGTGAGGTATACGTTGATAAACATGG
AAGAATAAAAGTACAGTTCCATTGGGATCGTTTGGGTAAGTACGATGTAAATAGTTCGTGTTGGATTCGA
GTTGCTCAAAGTGTTGCCGGAAATGGATGGGGTGCGGTGTTTCATCCTCGGGTAGGGCAAGAGGTTATCG
TAGAGTTTGTGAATGGCGACCCAGATCAACCTATTGTCACGGGTGCGCTGTATAACGGGAGCCAGTTGCC
CCCGTATTCTCTTCCAGAGAAAAGTTCTCAAAGCGGTTTTAAGTCCCGCTCAGTTCAAAAAGGAAACGCC
AATTTCAACGAGTTACGCTTTGAAGATAAACCTGGCGAAGAACACATTTACCTTCACGCAGAAAAGTTGT
TCCAAATGTTAGTCGAAGACTGCGTGGATATTGTGGTTGAGAACAATAAAGTTGAGAAAGTAACCAACGA
TGTAACTCAAGACGTTGGAAAAAATGCGATGTTAAAGGTGGGAGAGAACTATACCTCTGACACTGGAAAA
GTGTTGTCCCTCAATGCAGGGAAAAGTATTGAAATTAAAGTCGGTGGAGCCTCAATTCAAATGTCGAGTT
CTGGCGAAATCAACATTAAGGGCAACAAGATTTCTATCAATGGCTCTGCAATCGCATTGAAAGCAGGACA
AATCTCTTTGAATTAA
 Primer design