SecReT6
Protein ID: 433660103
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0933
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1050543..1051022 [-]
ProductPutative cytoplasmic protein USSDB7A
NoteTssD
UniProt IDL0I0I5
KEGG IDvpb:VPBB_A0933
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|433660103|ref|YP_007300962.1| Putative cytoplasmic protein USSDB7A [Vibrio parahaemolyticus BB22OP]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPD
LFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1051022-1050543 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAAGGTGAAGCGACAGCGGAACAATATAAGGATT
TAATTACACTACTATCTGTAGATTGGAGTGTTGGTCGTGAAATTTCTTCTTACACGGGTACAGCAATGGA
CCGTGAAGCAAGTGCAACACGCCTATATGATTTAACTATCACTAAACTTCAAGATCGTTCGTCTCCTGAT
CTATTCAAGGAAGCAACAATCGGTAAAGGTAAACCTGCAGTATTCCACATCACTAAGCAGGGTGAAAAAG
TTGAAGAAATCATGAAAATCGAACTGACTGATGCGATGATTTCTAACTACTCAGTATCGATTCAAGATGA
TCGCCCAGTAGAAACTATCACAATTTCATACACTGAAATGATGATGACAGTGACACCTACTGATGACAAA
AACAACACTTCTGCTCCGTTGGTTTACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA
 Primer design