SecReT6
Protein ID: 433660105
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0935
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1053806..1054771 [-]
Producthypothetical protein
NoteTssG
UniProt IDL0I562
KEGG IDvpb:VPBB_A0935
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-75, Aligned region: 8..307
Protein Sequence: 321 a.a.     [Download]
>gi|433660105|ref|YP_007300964.1| hypothetical protein VPBB_A0935 [Vibrio parahaemolyticus BB22OP]
MSTEDFYRELKQRSLFEAIHLIEQELLKVESQIGTDALPKNEKLNLKVNASLGFENAQLVSTKPLGKDKL
ALETNLIGLTGEQGVLPQHYSELALHRLKEGDHAMVDFYDIFNHRLLSLYYRSWQLSQLTIQARAHAKNQ
RSPLTDCMSSLTGGGNDLALHYGGMYASPTRSKGALKSILECLSGCQIRIHEFQGQWMRLSKSEQTRLVS
KSMPEGQFAQLGAGASLGKKAWNINASTTIEFLPKESKQVTNLLPKTNTLKTIKQVAGDFIGKHKHVKWQ
LTTKHSLLPQVQISKQQGQLGVGSVLKKHERTEDRNITITV
 
Nucleotide Sequence: 966 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1054771-1053806 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGAGCACAGAGGACTTCTACCGCGAGCTAAAGCAACGTTCTTTGTTTGAAGCTATTCATCTTATTGAGC
AAGAGCTTTTGAAAGTTGAATCGCAAATTGGAACAGATGCATTACCCAAAAACGAGAAACTTAACTTAAA
GGTCAATGCGTCTTTAGGGTTTGAGAATGCGCAACTCGTTTCTACTAAACCATTAGGTAAAGATAAATTA
GCGCTTGAGACAAATTTGATTGGCTTGACGGGGGAGCAGGGTGTACTGCCTCAGCATTACAGTGAGCTTG
CATTACATCGACTGAAAGAAGGCGATCATGCGATGGTGGACTTCTATGACATTTTTAACCATCGGCTTTT
ATCCCTCTATTATCGAAGTTGGCAGTTGAGTCAGTTAACCATACAAGCGCGTGCGCATGCAAAAAATCAG
CGCTCCCCATTAACTGATTGCATGTCGTCATTGACTGGCGGTGGGAATGATCTAGCACTGCATTATGGCG
GCATGTATGCATCTCCAACACGAAGTAAAGGTGCATTGAAGAGCATTTTGGAATGTTTGTCTGGTTGCCA
AATTCGTATTCACGAGTTTCAAGGTCAATGGATGCGACTGTCTAAATCTGAACAAACTCGTTTGGTATCG
AAAAGTATGCCCGAAGGCCAGTTTGCACAACTCGGTGCTGGTGCGTCACTAGGGAAAAAAGCCTGGAATA
TCAATGCAAGTACAACAATTGAGTTTCTCCCAAAGGAAAGTAAGCAAGTCACAAATCTATTACCCAAGAC
CAATACATTGAAAACGATAAAACAGGTAGCAGGTGACTTCATTGGCAAACACAAGCACGTTAAATGGCAA
CTCACGACTAAACATAGTCTATTGCCTCAAGTTCAAATATCTAAGCAACAAGGTCAGTTAGGTGTCGGCT
CTGTACTGAAAAAACATGAACGTACGGAAGATCGCAACATAACAATTACGGTTTAA
 Primer design