SecReT6
Protein ID: 433660106
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0936
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1054768..1056591 [-]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDL0I2I2
KEGG IDvpb:VPBB_A0936
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-191, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|433660106|ref|YP_007300965.1| Protein ImpG/VasA [Vibrio parahaemolyticus BB22OP]
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVEDPHVERLLEGCAFLTARIRQSLDNSYPQ
FTESLMGQLYPDFHAPIPSMSVIKLNCSESTTSSFAIPVGERVEVSAPGYQDCQFRTGYPTTMYPLDIIS
GSFENAPFKPTGSKWEHNAHSVLRCQLSAHDSESSINSMGIDCLRLYLNGQTQLTLKLYQMLFQSLIGLS
IVLDGKEIMPLTKRHLQSVGFGDEEQVVPYSKRSFSGSRLLVEYLHFPEKFMFFDLIELGLDKLEIQGQV
EICFYFDTSDDWLPKQVDEESVMVGCVPIVNLFKSTMEPKRLLPTEYEYQLSPQYQDAESNEVVSISDVT
LRNWNKTYEHLPCYHSGEHTHYMSASEVYWLMRREDKNWAGGYDEPGRETYVSFVDKQYQLFSPESRDNW
LMYVEAECCNRNLPQKIPFGGGLPKVQLPNVDDNFKSIRCLTSLSETLRPEMDESTRWQLTKLLTLNHFT
EADGLATLKQTLNLYAFAGTAETKAVIDALVKLEFEHTTGRVSQKGKVGFAHGVKLVLTVSDQILPKEQI
FLLGSVLSVYFAQYAEINVFTQLEIKLKSTSSSFHVWPALTGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1056591-1054768 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGAGTGAAGAGTTTCTAAAATACTACAATCGTGAATTGGCCTATCTGCGACACAAAGGACAAGAGTTTG
GCGAGCAATATCCTAAAATTGCGGCTAGGTTACGTATCAGCGAAGAACAAGTTGAAGACCCACATGTTGA
ACGTCTGTTGGAAGGTTGTGCTTTTTTAACCGCTCGGATAAGACAAAGTCTGGATAACAGTTACCCACAG
TTTACGGAATCACTGATGGGACAGTTATATCCGGACTTTCATGCGCCAATTCCTTCGATGTCAGTGATCA
AATTGAACTGTTCAGAGTCAACCACTAGTTCATTTGCTATTCCTGTGGGTGAAAGAGTCGAAGTTAGCGC
CCCTGGATATCAAGATTGCCAGTTTCGAACCGGTTACCCGACAACAATGTATCCACTCGATATTATCTCT
GGTTCATTTGAGAACGCGCCTTTCAAGCCTACTGGCTCTAAGTGGGAGCACAATGCGCACTCTGTACTAA
GGTGTCAGCTGAGTGCTCATGATTCAGAGTCCTCTATCAATTCCATGGGTATCGATTGTTTGCGTTTGTA
CTTAAATGGACAGACGCAATTAACACTCAAGCTATATCAAATGTTATTCCAAAGTTTGATTGGTCTTTCA
ATCGTGTTGGATGGTAAAGAAATCATGCCTCTAACTAAGAGGCATCTTCAATCGGTTGGTTTTGGGGACG
AGGAGCAAGTCGTCCCTTACAGTAAGAGAAGTTTTTCGGGATCTCGTTTATTGGTCGAGTACCTTCATTT
CCCAGAAAAATTCATGTTCTTTGACTTGATTGAGCTCGGCTTAGATAAGTTAGAGATTCAAGGGCAGGTC
GAGATTTGTTTTTACTTCGATACAAGCGATGACTGGCTACCAAAGCAAGTAGACGAGGAAAGTGTCATGG
TTGGCTGTGTTCCCATTGTAAATCTGTTCAAATCAACCATGGAACCTAAACGTCTCCTTCCAACAGAGTA
CGAGTATCAATTATCTCCTCAGTACCAAGATGCAGAGAGTAATGAAGTTGTCTCGATTTCTGATGTGACC
TTGAGAAACTGGAACAAAACTTACGAGCACTTACCCTGCTACCATTCAGGAGAGCACACGCACTACATGA
GCGCGAGTGAAGTGTATTGGTTAATGAGACGAGAGGATAAAAACTGGGCCGGTGGCTACGATGAGCCTGG
TCGAGAGACTTATGTTTCTTTTGTTGATAAGCAATACCAGTTGTTCAGCCCTGAAAGCAGAGATAATTGG
TTGATGTATGTGGAAGCTGAGTGTTGCAATCGTAATTTGCCACAAAAAATTCCATTTGGTGGCGGGCTAC
CAAAGGTTCAGTTACCCAATGTTGATGATAATTTTAAATCAATCAGGTGCTTAACGTCTCTCTCCGAAAC
GCTTAGGCCAGAGATGGATGAAAGCACACGATGGCAGCTTACCAAGCTATTAACATTGAACCATTTTACT
GAAGCTGACGGCTTAGCAACGTTAAAACAAACATTGAACTTGTATGCATTTGCAGGCACTGCCGAAACAA
AAGCCGTTATAGATGCTCTAGTCAAGCTAGAGTTTGAACATACAACCGGTAGGGTTAGTCAGAAAGGAAA
AGTTGGTTTTGCACATGGAGTAAAGCTGGTTCTAACAGTGTCCGATCAGATACTGCCAAAAGAGCAGATC
TTTTTATTGGGTAGCGTGTTATCTGTTTACTTTGCTCAATATGCGGAGATTAACGTGTTTACGCAGTTAG
AGATTAAGTTGAAATCAACCAGCAGCTCCTTTCACGTATGGCCTGCGCTGACAGGTGATAAGGTGTTGTT
ATGA
 Primer design