SecReT6
Protein ID: 433660107
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0937
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1056588..1057052 [-]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDL0I325
KEGG IDvpb:VPBB_A0937
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.90E-20, Aligned region: 27..129
Protein Sequence: 154 a.a.     [Download]
>gi|433660107|ref|YP_007300966.1| Uncharacterized protein ImpF [Vibrio parahaemolyticus BB22OP]
MALTVSLLDKLIDSDPTTREEKDFPVSQQHMLNGLLRDLESMLNSRIGWKNIHEDFLEVRYSILNYGLPD
FSSMPYSSQDGQSQLCDIVYEAIREFEPRLRNPHVQISDEKNAIDRTLRLEISATCLIDNDIHELKFNSE
VEPVNLGMKLSRAK
 
Nucleotide Sequence: 465 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1057052-1056588 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGGCTTTAACGGTTTCACTGCTAGACAAGTTGATTGATAGCGACCCAACTACCAGAGAAGAAAAAGATT
TTCCTGTCAGTCAGCAACACATGCTCAATGGTTTGTTAAGAGACTTAGAGTCGATGCTTAATAGTCGTAT
TGGTTGGAAAAATATTCACGAAGACTTTTTAGAAGTTAGATACTCAATTCTGAACTATGGGTTACCTGAT
TTTTCTTCAATGCCTTATAGCAGCCAAGATGGACAAAGTCAGTTGTGTGACATCGTTTATGAAGCTATTC
GGGAGTTTGAACCCCGGTTAAGAAATCCGCACGTTCAAATTTCTGATGAAAAAAATGCGATAGATCGAAC
CTTACGGTTAGAAATTAGCGCAACTTGTTTGATTGATAATGATATCCACGAGTTGAAATTCAATTCGGAA
GTCGAGCCTGTGAACTTAGGAATGAAGTTGAGTCGAGCGAAATGA
 Primer design