SecReT6
Protein ID: 433660108
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0938
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1057061..1057858 [-]
ProductProtein of avirulence locus ImpE
NoteTagJ
UniProt IDL0I0I9
KEGG IDvpb:VPBB_A0938
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.10E-39, Aligned region: 138..259
TPR_19 [PF14559], Evalue: 7.40E-05, Aligned region: 7..63
TPR_11 [PF13414], Evalue: 0.00025, Aligned region: 7..62
TPR_14 [PF13428], Evalue: 0.0026, Aligned region: 8..34
TPR_14 [PF13428], Evalue: 0.0026, Aligned region: 41..66
TPR_14 [PF13428], Evalue: 0.0026, Aligned region: 71..89
Protein Sequence: 265 a.a.     [Download]
>gi|433660108|ref|YP_007300967.1| Protein of avirulence locus ImpE [Vibrio parahaemolyticus BB22OP]
MTQWKNALSEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEYLPGASQ
LRHLVKAAQARKDFAQGAATAKVLGENEELTKSLVSFNLSMVSQDYEQVSELALQIEELRQEKGFLANDT
SFSDLRDIDDRLGGYIELFSTAGNYFLVPIASINTLEIKSTTSLLESVWRPVEFDIDGLGEGEGHMPMTY
VDSESDAQKLGRETDWKQIADEEVYLGLGLKCWLVGEMALPISDLQNLQVIKELA
 
Nucleotide Sequence: 798 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1057858-1057061 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGACTCAGTGGAAAAATGCCTTATCGGAAGGGCAGTTGCAACAAGCTTTAGAATTACTAATCGAAGCGA
TAAAGGCATCACCAAAGGATGCCAGTTTGAGAAGTTCTTTTATTGAGCTGCTTTGTATTGATGGTGATTT
TGAGCGAGCTGATGAGCAACTGATGCAGTCTATTAAACTGTTTCCTGAATATCTTCCAGGCGCTAGCCAG
TTAAGACATCTGGTTAAAGCTGCTCAAGCGCGAAAGGATTTCGCTCAAGGTGCGGCAACCGCGAAGGTAC
TGGGTGAAAACGAAGAACTAACTAAGTCATTGGTTAGCTTCAACTTATCAATGGTGAGTCAAGATTATGA
ACAAGTTTCTGAACTTGCTCTTCAAATCGAAGAACTGAGACAAGAAAAAGGCTTTTTAGCTAATGATACT
TCGTTCTCAGACTTGCGGGATATTGATGATCGTTTAGGTGGTTACATTGAGTTGTTTTCTACCGCTGGCA
ACTACTTTCTCGTCCCTATTGCTAGCATCAACACTTTAGAAATCAAATCTACAACCTCTTTGCTAGAAAG
TGTTTGGCGCCCAGTTGAGTTTGACATTGACGGTTTAGGTGAAGGTGAAGGCCATATGCCGATGACTTAC
GTGGATTCAGAAAGTGATGCTCAAAAACTGGGTCGTGAAACGGACTGGAAACAAATAGCAGACGAAGAAG
TTTACTTAGGTTTAGGTCTGAAGTGTTGGCTTGTCGGTGAAATGGCGCTGCCGATTTCTGACTTACAAAA
TCTACAAGTAATAAAAGAGTTGGCGTAA
 Primer design