SecReT6
Protein ID: 433660109
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0939
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1057869..1059380 [-]
ProductUncharacterized protein ImpD
NoteTssC
UniProt IDL0I4E1
KEGG IDvpb:VPBB_A0939
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-163, Aligned region: 66..497
Protein Sequence: 503 a.a.     [Download]
>gi|433660109|ref|YP_007300968.1| Uncharacterized protein ImpD [Vibrio parahaemolyticus BB22OP]
MTKIDALNFLDPEELTHEFTPMGLAEFDSHWLTQFVECSDSTLAARIWLEGTQSKDFASFRHSIVSTINT
IDTLLQKQLNEIIHHPDFQKLECSWVGVRYLCEQVDKPSSDSVKIKVLSATWNEVSKDALKAIEFDQSAL
FKLLYQNEYGMAGGEPFGVVVGDYQLRYDPRTNYFDRDISVLSKISQSAAAAFSPFVMSASPEIFGVNTF
AELSSTRDVAAQFEQIDYVKWRQLRDNDDTKFIGLTAPNVLFRQPYKSDGSRNDQFEFQENIDDSNNDLL
WGSGAFCFAAVSIRAFQEHGWFTHMRGIKQGDYSQGIIVAPTRNKTRINGKNDRDRCPLNLKVSERKEQE
LSDCGFIPISPVPETDMVGMTSNVSLHKPKLYEEKHVATNAKLTSMLQYTMCVSRIAHYVKVMGRDKIGG
YQDAASLEREFQTWLHQYTTASDEASDELRAKYPLNEAKIKVREKRDTPGHFYSVIHLRPHFQLDQMVSS
IKLITELSPEHLV
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1059380-1057869 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGACGAAAATAGATGCATTGAACTTTCTAGACCCAGAGGAACTCACACACGAGTTTACACCGATGGGCC
TGGCTGAGTTTGACAGTCATTGGTTGACTCAATTTGTTGAATGTTCAGATTCAACACTTGCGGCACGAAT
TTGGTTGGAAGGTACGCAATCTAAAGATTTTGCGAGTTTTCGCCATAGCATTGTGAGCACGATTAATACT
ATTGACACACTATTACAGAAGCAGCTCAATGAGATCATTCATCATCCAGATTTTCAGAAATTAGAGTGCA
GTTGGGTAGGTGTTCGATATTTATGTGAACAAGTTGATAAACCGTCGTCTGACTCAGTAAAAATTAAAGT
TCTATCTGCAACATGGAATGAAGTAAGTAAAGATGCGCTCAAGGCTATCGAATTCGATCAGTCTGCCTTG
TTTAAATTACTCTATCAAAATGAATATGGAATGGCCGGAGGAGAACCCTTTGGTGTGGTTGTTGGTGATT
ATCAATTACGTTATGACCCGAGAACAAATTATTTTGATAGAGATATCTCTGTGCTAAGCAAGATATCTCA
GTCTGCTGCTGCGGCATTTAGTCCATTTGTAATGTCAGCGTCTCCTGAAATATTCGGTGTGAACACATTT
GCCGAACTTTCGTCGACTCGAGACGTTGCTGCGCAATTTGAACAAATTGATTATGTCAAATGGAGACAGT
TGCGAGATAACGATGATACCAAGTTTATTGGCTTAACCGCTCCTAACGTGCTTTTTCGACAACCCTACAA
AAGTGATGGTTCTCGAAACGATCAATTTGAATTTCAAGAGAATATTGACGATTCAAATAACGATTTATTG
TGGGGAAGTGGAGCCTTCTGTTTCGCTGCTGTTTCGATAAGAGCATTCCAAGAGCACGGTTGGTTTACTC
ATATGCGAGGAATAAAGCAGGGGGATTATAGTCAAGGCATTATTGTTGCTCCTACAAGAAACAAAACGCG
CATTAATGGCAAAAATGACAGAGATAGATGCCCTTTAAATCTAAAAGTCTCTGAGCGTAAAGAGCAAGAA
CTGTCTGATTGTGGATTCATTCCGATTTCACCAGTTCCTGAAACAGACATGGTTGGCATGACTTCCAATG
TTTCGTTGCATAAGCCAAAACTGTATGAAGAGAAGCATGTTGCGACTAATGCAAAACTCACCTCAATGCT
CCAATACACGATGTGTGTATCGCGTATAGCACACTACGTCAAAGTTATGGGGCGAGACAAGATAGGTGGT
TATCAGGACGCGGCATCGCTCGAGAGGGAGTTTCAGACTTGGTTACATCAATATACAACGGCTTCAGACG
AAGCTTCGGATGAACTCAGAGCTAAGTACCCATTGAACGAAGCGAAGATCAAAGTTAGAGAGAAACGCGA
TACGCCAGGGCACTTCTACTCGGTGATACATTTACGTCCTCATTTTCAGCTCGACCAAATGGTCTCAAGT
ATCAAATTAATTACGGAATTATCACCAGAACATTTGGTGTAA
 Primer design

Protein ID: 433660110
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0940
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1059436..1060929 [-]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDL0I565
KEGG IDvpb:VPBB_A0940
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-184, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|433660110|ref|YP_007300969.1| Uncharacterized protein ImpC [Vibrio parahaemolyticus BB22OP]
MTTQVEKQLDPTVGEQTTSFLEQAIGATKQTEASRAEELIKTLTEEAMKGTVSWNKNLTVTFREAINLLD
RQISEQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKIRMISITKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLD
KVFESLEYAQWRSFRESADSRFVSLTMPKVLARLPYGQATSPVEAFGFEEFDVDPVSGIAVNADHNDYCW
MNSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPANHESPEVAANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGSPGSYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1060929-1059436 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGACGACTCAAGTTGAAAAACAACTCGATCCTACGGTGGGTGAACAAACCACTTCATTTCTTGAACAGG
CTATTGGTGCGACGAAACAAACAGAAGCATCGAGAGCAGAAGAGCTGATCAAGACACTGACTGAAGAAGC
GATGAAGGGGACGGTTTCTTGGAATAAAAACCTAACCGTAACTTTCCGTGAAGCGATCAATTTGCTTGAT
AGACAGATTTCAGAGCAGCTTTCTGAAGTTATGCACCATCCTGAGCTACAAAAGTTAGAAGGCTCATGGC
GTGGGCTGAATTACTTAGTCATGAATTCTGAGACAAGTTCTACGCTGAAAATTCGCATGATCAGCATCAC
GAAGAAAGAGCTTCATAAAGACTTAAGTAAAGCGGTTGAATTCGATCAAAGTCAAATCTTTAAAAAAGTG
TACGAATCTGAATTTGGTAGCGCTGGTGGTGAACCGTATGGTGCTTTAATTGGTGACTACGAGTTTACAA
ACCATCCAGAAGATATTGAGTCTTTGCGTTTAATGTCGAATGTTGCTGCTTCGGGTTTCTCACCATTCTT
GTCTGCTGCTTCTCCTGCGCTATTTGGTTTTGATGAGTGGACAGAACTATCTAAACCGCGCGATTTAGAT
AAAGTCTTTGAGTCGTTGGAATATGCGCAATGGCGCTCTTTCCGTGAAAGTGCAGATTCTCGTTTTGTAA
GCTTAACGATGCCTAAAGTATTAGCTCGCTTGCCATACGGCCAAGCTACCTCTCCTGTAGAAGCGTTTGG
CTTTGAAGAGTTTGATGTGGATCCTGTGTCGGGTATCGCCGTTAATGCTGATCACAATGATTATTGTTGG
ATGAACTCATCGTACGTGCTTGGCGTCAAACTGACGGATGCATTTTCTAAGTATGGTTTCTGTACTGCTA
TTCGTGGCGCAGAGGGTGGTGGGCGAGTTGATAACTTACCAACACACTTCTTCATGAGTGATGATGGTGA
CCCAGATATGAAGTGCCCAACGGAAATTGGCATTACAGACCGCCGTGAAGCGGAATTGGGTAAACTGGGT
TTCTTACCGTTGTGTCACTACAAAAATACGAACTATGCCGTGTTCTTTGGTGCTCAAACTTGTCAAAAAC
CAGCAAATCATGAATCTCCAGAAGTGGCAGCAAACGCGGCAATTTCAGCAAGACTTCCTTACATGATGGC
AACCTCTCGTTTTGCACATTATTTGAAAGTAATGGCTCGAGACAAGATCGGTAGCTTTATGGAAGCAGAA
GACGTTGAATCTTGGTTGAACCGTTGGATTCTTGGCTATGTGAACGCTTCTGAAGGTGGCGGTCAAGAAA
TTCGTGCGAAATACCCTCTTGCCGACGCTCGCGTACAAGTTAAGGAAATTCCAGGTTCTCCTGGTTCTTA
CAACGCGGTTGCTTGGCTCAAGCCATGGCTTCAAATGGAAGAGCTAACCACGTCTTTAAGACTCGTTGCT
AAAATTCCTCAGTCGGGTGGCTAA
 Primer design