SecReT6
Protein ID: 433660111
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0941
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1060929..1061375 [-]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDL0I2I6
KEGG IDvpb:VPBB_A0941
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-51, Aligned region: 2..134
Protein Sequence: 148 a.a.     [Download]
>gi|433660111|ref|YP_007300970.1| Uncharacterized protein ImpB [Vibrio parahaemolyticus BB22OP]
MKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDVLKKMSPSVKFKVANKLANDDSEFAVELS
FKSMQDFEPAAIVNQVEPLRQLMETRNKLRDLMTKVDRSEELENILEEVLNNTDNLAKLAGELDLGKKAP
SESTEGAE
 
Nucleotide Sequence: 447 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1061375-1060929 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
TTGAAAAAAGAGCTTCCTTTTGTGGTGGGTGTTATGGGCGACTTTGCAGGCCAAAATACCGAAGCATTGA
AACCATTAAAGGATCGCCGTTTCATTCAAATCGATCGTGATAACTTCGATGATGTACTTAAAAAGATGAG
TCCATCGGTTAAGTTCAAAGTCGCAAACAAGTTAGCAAATGACGATTCTGAATTTGCGGTTGAACTGAGC
TTTAAATCGATGCAAGACTTTGAACCAGCAGCGATTGTCAATCAAGTAGAACCATTGCGTCAGCTGATGG
AAACTCGTAACAAACTGCGAGACTTGATGACTAAAGTCGACCGTTCGGAAGAGCTTGAAAACATCCTAGA
AGAAGTTCTCAACAATACAGACAATTTGGCAAAACTAGCTGGTGAGCTAGATCTTGGCAAAAAAGCGCCA
TCAGAAAGTACTGAGGGAGCAGAATAA
 Primer design