SecReT6
Protein ID: 433660112
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0942
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1061475..1062596 [-]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDL0I330
KEGG IDvpb:VPBB_A0942
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 67..127
Protein Sequence: 373 a.a.     [Download]
>gi|433660112|ref|YP_007300971.1| Uncharacterized protein ImpA [Vibrio parahaemolyticus BB22OP]
MSNTMFDWYEEVLAPVSEDNPTGIDPREDVSPQSAYYRLKDQRMVARNAERNAIIEEESIHTHNNLWRVF
VEEVPEVLATQSKDFEFVAWLIEALTRLYGFRGMGVGYKIASAFVESYWDELHPMPDEDGIETRISAITG
LNGIDSEGTLIFPLASIPLTDMGVEQAYAYWEYQQAIELERLDEDKRRARVDQGAIELSRITDTVKSTSD
EFYQSLIADLEFATGAFNEFSQRLDEAVGDVTPSSYISKRIESIHAALKHLLGNRFKDKAEVSISDENGD
EELEEASQQAVTHNSSALLVTNMQSREQAIQQLQHVADFFRESEPHSPVSYSIEQIIRWCGMPLPELLAE
LISDGDAKRSYFRLVGIAEQNEN
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1062596-1061475 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGAGTAACACGATGTTTGATTGGTATGAGGAAGTCCTTGCACCAGTTTCGGAAGACAATCCGACTGGCA
TTGATCCAAGAGAGGATGTCTCTCCTCAGTCTGCTTATTATCGACTTAAAGATCAGCGAATGGTAGCAAG
AAACGCAGAGCGAAACGCCATCATCGAAGAAGAAAGTATTCACACACATAACAACTTATGGCGCGTTTTT
GTTGAAGAAGTACCAGAAGTTCTCGCTACACAATCAAAAGATTTTGAGTTTGTTGCCTGGCTAATAGAAG
CATTAACTCGGCTTTATGGTTTTAGAGGCATGGGCGTAGGCTACAAAATTGCTAGCGCGTTTGTTGAGTC
ATATTGGGATGAGTTGCACCCAATGCCTGATGAAGACGGCATAGAAACGCGGATTTCTGCCATCACCGGA
CTTAATGGTATTGATAGTGAGGGAACGCTGATCTTTCCTCTTGCCTCGATTCCGTTGACGGATATGGGGG
TAGAGCAAGCTTATGCATATTGGGAATACCAACAAGCCATTGAACTCGAGCGCTTGGACGAAGACAAACG
AAGAGCGCGAGTAGATCAAGGCGCAATTGAATTGTCGCGTATCACTGACACTGTGAAATCAACGTCAGAT
GAGTTTTACCAGTCTCTGATTGCAGATCTCGAGTTCGCTACAGGTGCTTTTAATGAGTTCAGTCAGCGAC
TTGATGAGGCTGTAGGGGATGTAACGCCTAGCTCATATATTTCAAAAAGAATTGAATCAATACACGCGGC
ACTTAAGCACTTGTTGGGTAATCGTTTTAAGGATAAGGCTGAGGTCTCCATTTCTGACGAAAATGGTGAT
GAAGAGTTAGAAGAAGCAAGTCAACAAGCAGTTACTCACAACTCATCTGCGTTATTAGTTACAAACATGC
AATCTCGAGAACAAGCTATTCAACAGTTGCAACATGTGGCGGACTTTTTTAGAGAAAGCGAGCCTCACTC
ACCAGTTTCTTACTCCATCGAACAAATTATTCGTTGGTGTGGAATGCCTCTGCCTGAATTACTGGCGGAA
CTAATCTCCGACGGAGACGCAAAACGAAGCTACTTCCGTTTGGTTGGCATAGCAGAACAAAATGAAAATT
AA
 Primer design