SecReT6
Protein ID: 433660115
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0945
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1064069..1067599 [-]
ProductIcmF-related protein
NoteTssM
UniProt IDL0I570
KEGG IDvpb:VPBB_A0945
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-87, Aligned region: 506..809
ImcF-related_N [PF14331], Evalue: 1.40E-85, Aligned region: 194..456
DUF1215 [PF06744], Evalue: 1.60E-38, Aligned region: 923..1038
AAA_16 [PF13191], Evalue: 0.0042, Aligned region: 44..119
AAA_16 [PF13191], Evalue: 0.0042, Aligned region: 129..196
AAA_19 [PF13245], Evalue: 0.0053, Aligned region: 131..146
Protein Sequence: 1176 a.a.     [Download]
>gi|433660115|ref|YP_007300974.1| IcmF-related protein [Vibrio parahaemolyticus BB22OP]
MGNEMSIKEIGRVFTQRWFLGLVGVAACSIFIWVVGPLITVAGYEPLKSDFQRLVTILVIVFAWALINLT
KQHKQKVREDESIQTLLEVDSQSDKEAASEIDVMRDRIEQAIKVVTKTHKGKRSLYDLPWYVLIGPPGTG
KTTVLKQSGLEFPLAESLGADSIAGVGGTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLL
KKYRTQRPINGAIVTVSLASVMSQTRTERSLHARSIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFF
ADLSKEEREELFGFMFSREVDDERGVISLFNKEFHGMLERLDARMLRILETEDDLEKRTLIFEFPKQLRV
LQANLDEFLSEIFAQNTFEEPALIRGVFLLSSVQEGIPVDRLMSESTHGLGLGRLPLATNVNSSHSYFVK
NLFERVIFKEQLLGTVNRHYQKQSGWMRTGIYVGCVGVLVGASALWFLSYQWNSKLIVDTNSQVNHIEAM
IGAESLDFESDVISAVDTLDKIMMLPLGKNSKYGHSDAVKKFGLYQGDKVSQAANNAYSDALSQHFATLL
SESLVSEMEANKQHREYLYETLKTYLMLFNPEKYQQEEVIAWFNFYFERQYPGELNKELRERLLVHTKNL
LENDEKGFSMDATAISAAREVLTQMSLPERAYQRMKMQFAKSHVPSFRLTDVLGPKGLEQFERASGKPLS
QGISGFYTYNGFHSIFQIQINRTVKGLMEENWVYGDDLKAHEIDHDSAIQGVQARYYQDYVNEWKTLIED
IQLKQAPSLALATEQSRVLSGVERPIESLLRAIQKEVGLSKVTLSENQKAATEVAGKVAKVKFSNTADKL
DMYLPEENGFNVALPGKEVESHFTEILRLSEQDFDDIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTV
THDVAASFARAKDLLPKPFNQWLGELSQESVKFAESGSKDHLNQLWVTNVVRPYQRTIAGRYPFEPNATK
EVRLKDFQRFFGYGGTLDSFFQEYLEPFVDTSKSRWRLEKEIGVRPETLAVFQRAKRIRQSFFESDNSLR
VEFGMKPVYLDQHITRFVLELGDQDLVYKHGPARSKELRWPSGQDQTRIVFTPPESKREIAHTYEGEWGI
FKLLDQSLKARPESRNDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERFRCPQTL
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1067599-1064069 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
TTGGGCAATGAAATGAGTATTAAAGAAATAGGCAGAGTATTTACCCAAAGATGGTTTCTTGGTTTAGTTG
GTGTAGCCGCGTGCTCCATTTTTATTTGGGTTGTGGGTCCTCTGATCACGGTTGCAGGTTACGAGCCGCT
TAAAAGTGATTTCCAACGTTTAGTTACGATCTTAGTGATTGTTTTTGCTTGGGCGCTTATCAACTTAACA
AAGCAGCACAAACAGAAAGTTAGAGAAGACGAAAGTATTCAGACGTTGCTTGAAGTAGACAGTCAGTCAG
ACAAAGAAGCCGCCAGTGAAATTGACGTAATGCGCGATCGTATAGAGCAAGCGATCAAAGTTGTGACAAA
AACGCATAAAGGAAAGCGTAGTTTGTACGATTTACCTTGGTACGTTCTGATTGGTCCTCCTGGAACAGGT
AAAACCACGGTTCTAAAGCAATCTGGCTTGGAATTTCCGTTAGCTGAGAGCTTAGGGGCTGACTCTATAG
CTGGTGTAGGTGGAACACGTCACTGTGATTGGTGGTTTGCTAATAAAGCAGTACTTATTGATACAGCAGG
ACGTTACACCACGCAAGATAGTCAAGAAAAGGTTGACTCTAAAGCTTGGCACGGTTTCTTGGGGTTACTT
AAGAAATATCGTACTCAAAGGCCTATCAATGGCGCTATCGTAACAGTCAGCCTAGCAAGTGTGATGTCTC
AAACTCGTACGGAGCGTAGCTTACATGCCAGATCAATAAAATCTCGCCTTCAGGAACTCAAAAATCAGTT
GGGTATGCAATTCCCAATCTATGTTCTGCTGACGAAAATGGATCTGGTTGCTGGCTTTAATGAATTTTTT
GCTGATTTAAGTAAAGAAGAGCGTGAGGAACTTTTTGGATTTATGTTCTCACGAGAAGTTGATGACGAAC
GTGGTGTCATTTCTCTCTTTAATAAAGAGTTTCACGGCATGTTGGAGCGGCTCGATGCGCGCATGTTACG
TATATTAGAAACTGAAGATGACTTAGAAAAGCGCACGCTAATATTCGAATTTCCAAAACAGCTGCGAGTT
TTACAAGCAAACTTAGATGAGTTTTTGTCTGAGATATTTGCGCAGAACACGTTTGAAGAGCCAGCCCTTA
TTCGCGGTGTTTTCTTGCTTAGCTCTGTACAAGAAGGCATTCCTGTTGATCGACTGATGAGTGAATCAAC
TCATGGATTGGGACTAGGGAGGTTGCCTTTAGCGACAAACGTTAACAGTTCGCATAGCTATTTTGTTAAA
AATCTTTTTGAGCGAGTCATCTTTAAAGAGCAATTACTAGGTACCGTTAACCGCCACTATCAAAAGCAAT
CTGGATGGATGCGTACGGGCATATACGTGGGTTGTGTTGGTGTTCTTGTTGGTGCTTCTGCTCTTTGGTT
CCTGAGTTATCAATGGAATTCAAAGTTAATTGTCGATACCAATAGCCAAGTAAATCATATTGAAGCGATG
ATAGGTGCAGAGAGCCTTGATTTTGAATCGGACGTTATCAGTGCTGTAGACACGTTAGACAAGATCATGA
TGTTGCCACTAGGGAAAAATAGTAAATATGGTCATTCTGATGCAGTGAAAAAGTTTGGTCTGTATCAAGG
TGACAAAGTTTCTCAAGCAGCAAATAACGCGTATTCAGATGCTCTTTCTCAACACTTTGCTACTCTGTTG
TCAGAGAGTTTGGTCTCGGAAATGGAAGCGAATAAGCAGCATCGTGAATACTTATACGAGACGTTAAAGA
CGTATTTAATGTTGTTTAATCCGGAAAAGTATCAACAAGAAGAGGTAATTGCTTGGTTCAACTTCTACTT
TGAACGTCAGTATCCAGGAGAGTTAAACAAAGAGCTACGTGAGCGTTTGCTAGTGCATACTAAAAACTTA
CTAGAGAACGACGAGAAAGGCTTCTCAATGGATGCGACTGCTATTAGTGCAGCACGAGAAGTTCTAACGC
AAATGTCACTTCCAGAGCGTGCATATCAGCGTATGAAGATGCAGTTTGCTAAAAGCCACGTTCCGTCTTT
CCGTTTAACAGACGTGTTAGGACCTAAAGGTTTAGAACAATTTGAGCGAGCAAGTGGAAAACCTCTATCG
CAAGGTATTTCCGGTTTTTATACCTACAACGGTTTTCACAGCATTTTCCAAATTCAGATTAATCGCACCG
TCAAAGGTTTGATGGAAGAAAACTGGGTGTATGGGGATGATCTTAAAGCTCATGAAATTGATCATGATAG
TGCTATTCAGGGGGTTCAAGCCCGCTATTATCAAGATTATGTCAATGAGTGGAAAACTCTGATAGAGGAT
ATTCAGCTTAAACAAGCTCCGAGTTTGGCTTTAGCAACAGAGCAATCAAGAGTTTTATCCGGTGTAGAAA
GACCAATTGAATCACTTCTGCGTGCAATACAAAAGGAAGTGGGGTTATCGAAAGTAACGTTATCGGAAAA
TCAAAAGGCAGCAACGGAAGTCGCAGGAAAGGTTGCAAAAGTGAAGTTTTCTAATACGGCAGACAAACTC
GATATGTATTTGCCTGAAGAGAATGGATTTAATGTTGCTCTACCAGGTAAAGAAGTTGAATCCCATTTCA
CCGAAATCTTACGACTTAGTGAACAAGACTTTGATGATATTCAGCAAGCGATGGTGAATTTGCGTTCGTA
CTTATCTGATTTGTCTAGCTCTGGCAACAATCAAAAAATTGCTTACAAAAGCATATTGGATGGAACGGTG
ACTCATGATGTTGCTGCCTCCTTTGCTAGAGCAAAAGATCTCTTACCAAAACCGTTTAATCAATGGTTGG
GAGAGTTGTCACAGGAATCGGTTAAGTTTGCAGAAAGCGGCTCTAAAGATCATCTAAATCAGCTTTGGGT
GACTAATGTAGTGCGTCCTTATCAGCGGACTATAGCAGGTAGATACCCATTTGAACCTAATGCAACGAAG
GAAGTTCGTCTAAAGGACTTTCAACGATTCTTCGGGTACGGTGGTACGTTGGACTCGTTCTTCCAAGAAT
ATCTGGAGCCGTTTGTTGATACGTCTAAGAGTCGTTGGAGACTAGAAAAAGAAATCGGTGTAAGGCCCGA
GACGCTTGCAGTTTTTCAAAGGGCAAAACGCATTAGACAATCGTTCTTTGAATCAGATAACTCGCTACGA
GTCGAGTTTGGTATGAAACCCGTATATCTAGATCAACACATTACTCGATTTGTGCTAGAGCTAGGTGATC
AAGACTTGGTTTATAAGCACGGTCCTGCGAGATCGAAGGAACTTCGCTGGCCATCGGGTCAAGATCAGAC
GCGTATTGTGTTTACACCGCCCGAATCAAAACGAGAAATTGCTCATACCTATGAAGGGGAATGGGGCATT
TTCAAACTATTGGACCAATCACTCAAGGCTCGACCAGAGTCTCGCAACGACAACATTGTCATGATCGATT
TGAAGGGGAACAAGGTTCAGCTTGAGTTGATTCCATCTAGTGCAATCAACCCATTTTGGTCTAATGAGAT
GGAGAGGTTCAGATGTCCGCAAACCTTGTAA
 Primer design