SecReT6
Protein ID: 433660116
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0946
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1067603..1068895 [-]
ProductType VI secretion system family protein
NoteTssL
UniProt IDL0I2I9
KEGG IDvpb:VPBB_A0946
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.70E-62, Aligned region: 49..254
OmpA [PF00691], Evalue: 3.90E-14, Aligned region: 251..270
OmpA [PF00691], Evalue: 3.90E-14, Aligned region: 322..420
Protein Sequence: 430 a.a.     [Download]
>gi|433660116|ref|YP_007300975.1| Type VI secretion system family protein [Vibrio parahaemolyticus BB22OP]
MEQTIVKPTPGGRAAVSKAQPQRSADSTVVISKSPELVNNDSVVAYGDNPLLAEANGLLSIIGQIRATAT
HSDPLFLKETLAQKLRDYENRLRQHDVDLETIDTARYCLCCSLDEAVLNTNWGSQSFWTHDSLLSSFYAS
SQGGEAFFKHLDSCLAHPESHLDLLELMYVCLSLGFIGQYRLEKNGLEAHRRLRKQVVSVLKSHGRGVQQ
ELSNKVEQHILAGAQVSERAPLWVVCSVTSALLVCIFMYFSYELNKASNQTFAQLVNLIQPTPAVSNPMV
ESKSAPIAERISMYLATEIGKDLVTVEALQDRVRISLKAQDLFESGSASVVAYIQPVISKVARTLEATQG
KIIITGHTDDRPIFTSKYPSNWHLSLARATSLSEQLISNSALKGRVIPEGLGDARPLVENDSEENRAMNR
RIEIDLIVGN
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1068895-1067603 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGGAACAGACGATAGTAAAACCTACTCCTGGCGGAAGAGCGGCTGTATCTAAAGCTCAGCCTCAAAGAT
CAGCAGACAGTACTGTTGTGATATCCAAAAGCCCTGAGTTGGTTAACAACGATTCAGTTGTTGCTTATGG
AGATAATCCACTATTGGCAGAAGCTAATGGTCTACTTTCGATTATTGGACAAATCAGAGCAACAGCTACT
CATTCCGATCCTTTGTTTCTTAAAGAAACGCTCGCGCAAAAACTTAGGGATTATGAGAATCGTCTGCGTC
AACATGATGTTGACTTGGAAACCATTGATACCGCACGTTATTGTCTGTGCTGTTCTTTAGACGAAGCAGT
ATTGAATACCAATTGGGGGAGTCAATCGTTTTGGACACATGATTCTCTGTTGAGTTCTTTTTACGCGAGC
AGCCAAGGTGGAGAGGCTTTTTTTAAGCATCTAGATAGCTGTTTGGCTCATCCGGAATCCCACCTAGATT
TACTAGAGCTAATGTACGTATGCTTATCTTTGGGTTTTATAGGTCAGTATCGTTTAGAAAAAAATGGGCT
TGAAGCTCACCGTAGATTGAGAAAACAAGTTGTATCAGTGCTTAAGTCACATGGTCGCGGAGTACAGCAA
GAGCTTAGTAACAAAGTAGAACAACATATATTGGCAGGTGCTCAGGTTTCGGAACGTGCTCCTCTATGGG
TGGTTTGTTCGGTAACTTCCGCACTGCTTGTTTGTATTTTTATGTACTTCAGCTACGAGTTGAACAAAGC
TTCCAACCAAACTTTTGCTCAATTGGTAAACCTGATTCAACCAACCCCAGCAGTTAGTAATCCTATGGTT
GAGTCAAAGTCAGCACCTATTGCCGAAAGAATATCTATGTATTTGGCAACGGAGATTGGCAAGGATCTTG
TCACTGTGGAAGCGTTGCAAGATAGAGTTCGTATTTCTCTTAAAGCTCAAGACCTATTTGAATCTGGTAG
TGCGAGCGTTGTGGCTTACATACAGCCAGTTATTTCTAAAGTTGCACGCACCTTAGAAGCGACACAAGGG
AAGATCATAATTACCGGGCATACCGATGACCGTCCGATATTTACCAGCAAGTACCCATCCAATTGGCACT
TGTCTTTAGCTCGGGCAACTTCTCTTTCCGAACAGTTAATCTCCAACAGTGCACTTAAAGGAAGAGTGAT
TCCTGAAGGGTTGGGTGATGCGAGACCTTTGGTAGAAAATGACAGTGAAGAGAACCGAGCAATGAATCGT
CGAATTGAAATCGACCTTATTGTGGGCAACTAA
 Primer design