SecReT6
Protein ID: 433660117
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0947
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1068907..1070196 [-]
Producthypothetical protein
NoteTssK
UniProt IDL0I335
KEGG IDvpb:VPBB_A0947
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-129, Aligned region: 7..427
Protein Sequence: 429 a.a.     [Download]
>gi|433660117|ref|YP_007300976.1| hypothetical protein VPBB_A0947 [Vibrio parahaemolyticus BB22OP]
MFLRPQHFQQHERAISNEYKGLHSLGGSYNWGVWNCRVKEHALKTGLIELDNLQAILPDMTLIDFSATTS
FLSPLKVKKGTENTLVKVIVPLSKVSSKMIADPSETTVSRYLLQDLDVIDNLTGQDEETIQVASLNIELK
SSNEQLTGYIELPILKIKEVSTEGEVILDDSYVPPLLNLLNDKVMTGYLRNAMAMTKIRADVIAQRLVKG
KAASASAVDFIMLQMLNRYEAILKHFSELEKVHPLELATTFKGYIGELATFSHTTKRLPNLKAYDHLEVA
SVFVELNQVLSQYLSVVLDQTASKLPLEVRQYGIQVTPLPDKRLLESCQFVLAIKADTTTDEIRRLVPAQ
LKLGPAEQIRDLINNQINGINVAPLSVVPRQIPYQTGYVYFEVVKKGPFWMRLKDSGGIALHLSGHFPNP
DIELWSINQ
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1070196-1068907 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGTTTCTGCGTCCCCAGCATTTTCAACAGCACGAACGCGCAATATCTAATGAATATAAAGGCTTACACA
GTTTAGGGGGCTCATATAACTGGGGCGTTTGGAATTGCCGTGTAAAAGAACATGCCTTAAAAACAGGCTT
GATTGAACTTGATAATCTTCAAGCAATTCTTCCTGATATGACGCTGATAGACTTTTCAGCAACAACAAGT
TTTCTGTCTCCTTTAAAGGTAAAAAAAGGGACGGAAAATACCTTAGTGAAGGTGATCGTTCCACTCTCAA
AAGTCAGCAGTAAAATGATCGCGGATCCAAGTGAAACAACGGTTTCTCGGTATTTACTTCAAGATCTAGA
TGTTATTGATAACCTGACGGGCCAAGATGAAGAAACGATTCAAGTGGCCTCATTAAATATCGAGCTGAAA
TCAAGCAATGAGCAGTTAACAGGTTATATAGAGCTACCAATCCTTAAGATTAAAGAAGTTTCTACGGAAG
GAGAGGTCATTCTTGATGACTCTTACGTACCACCACTTCTAAACTTGTTAAATGACAAGGTGATGACAGG
GTATCTACGTAATGCAATGGCAATGACCAAGATACGCGCAGATGTTATCGCTCAACGACTTGTTAAAGGA
AAAGCGGCTTCAGCATCTGCGGTAGATTTCATAATGCTACAAATGTTGAATCGATATGAAGCCATATTGA
AGCATTTTAGTGAGCTGGAGAAAGTACACCCCTTAGAGCTTGCGACAACCTTTAAAGGCTACATAGGCGA
GTTGGCAACGTTTTCTCACACCACCAAGCGCTTACCTAATCTCAAAGCTTACGATCACCTTGAAGTTGCA
AGTGTGTTTGTTGAACTTAATCAAGTCCTTAGTCAGTACTTGAGTGTCGTTCTTGATCAGACTGCAAGCA
AGTTGCCACTAGAAGTACGCCAGTACGGTATTCAAGTGACACCACTTCCAGATAAGCGACTATTGGAATC
ATGTCAGTTTGTATTGGCGATTAAAGCGGACACAACAACGGATGAGATTAGACGCTTAGTCCCTGCGCAA
TTGAAGCTTGGTCCGGCAGAACAGATTAGAGATCTAATCAACAACCAGATTAATGGAATTAACGTAGCTC
CTTTAAGTGTCGTGCCGCGACAGATTCCATATCAAACCGGGTATGTTTATTTTGAGGTCGTTAAGAAGGG
GCCATTCTGGATGCGACTTAAAGACAGCGGTGGTATTGCACTGCATTTATCTGGTCATTTCCCAAATCCG
GACATAGAGCTTTGGAGCATTAATCAATAA
 Primer design