SecReT6
Protein ID: 433660118
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0948
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1070254..1070709 [-]
ProductType VI secretion protein
NoteTssJ
UniProt IDL0I0K1
KEGG IDvpb:VPBB_A0948
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-40, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|433660118|ref|YP_007300977.1| Type VI secretion protein [Vibrio parahaemolyticus BB22OP]
MKQIYKSFLLFIFLVLMGCSAANLVVDPYADLEITANHNINPDSNGRPSPVVVYVFELTSNTLFESQDFF
SIYEEHEKVLGPDLVNKYEISLTPGQKEIYQASMSPKTEYLGIVAAFRDIENSNWRQVIKVDKTGYNTYQ
ISLEDLSLVVQ
 
Nucleotide Sequence: 456 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1070709-1070254 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
GTGAAACAAATTTATAAATCATTTTTGCTGTTTATATTTTTAGTATTAATGGGATGCTCCGCCGCTAATT
TAGTGGTCGACCCATATGCGGATTTAGAAATAACGGCAAATCATAATATCAACCCTGACTCGAATGGAAG
ACCATCACCAGTTGTTGTATATGTATTTGAACTTACATCAAATACACTGTTTGAGAGCCAAGATTTTTTC
TCTATTTATGAGGAGCATGAAAAAGTACTCGGTCCAGACTTGGTGAATAAATATGAAATATCTTTGACAC
CAGGCCAAAAAGAAATCTACCAAGCTAGTATGTCTCCTAAAACAGAATATTTGGGTATCGTAGCCGCGTT
TCGCGATATTGAGAATTCAAATTGGCGACAAGTCATTAAAGTAGATAAGACGGGTTACAACACTTATCAA
ATCTCGTTAGAAGATCTGTCTTTGGTCGTACAATAA
 Primer design