SecReT6
Protein ID: 433660119
SecReT6 ID720
T6SS typei5
Gene symbol-
Locus tagVPBB_A0949
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome II [GenBank: NC_019971] [Browse all T6SS(s) in this replicon]
Location [Strand]1070719..1071915 [-]
Producthypothetical protein
NoteFha
UniProt IDL0I4E9
KEGG IDvpb:VPBB_A0949
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.10E-16, Aligned region: 32..101
FHA [PF00498], Evalue: 3.10E-16, Aligned region: 376..386
Protein Sequence: 398 a.a.     [Download]
>gi|433660119|ref|YP_007300978.1| hypothetical protein VPBB_A0949 [Vibrio parahaemolyticus BB22OP]
MKLVLTITSFHKFTPEIESEFVFESSDEHAKVTFGRSEQCDWTLPDPERVISGTHGELIKFGDKYLIKDL
STNGTFVNNAVTPIGQGNELALSHGDTVALGDYQILISISDIPEDRTEHQFTSKPEVKTPVEFEQHVESI
PEVEDFGLSAAELMDESVPSDFQLDIGLVDDFLEIPSHETEVPQPKVASMQPDTNAKSQKPTVHRGELEA
FIYGMGIDPNMVPSQNREQWFEQLGQSFSLMLIGLMETLHNRAVFKQTNRVNHTAFRKSENNPLKFSANL
EDAIHNLYNRQTSSFLKPNAAIKEAFNDIENHEQALMQGVAGTVSSVMSLVEPNTIYSDALAKDNVINKV
IPARKYAQSWKRFEGIHSQLTDELVNKESPFYLEDFAKHYELALKNKG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|433659170|ref|NC_019971.1|:c1071915-1070719 Vibrio parahaemolyticus BB22OP chromosome 2, complete sequence
ATGAAATTGGTATTGACCATAACGAGTTTCCACAAATTTACTCCGGAAATAGAGAGTGAGTTTGTGTTTG
AATCAAGTGATGAGCATGCAAAGGTAACCTTCGGACGCTCAGAACAATGTGACTGGACGTTACCAGACCC
TGAGAGAGTTATTTCTGGGACTCACGGCGAATTGATTAAATTTGGCGATAAATATCTAATTAAAGATTTA
TCAACAAATGGCACATTTGTTAATAATGCAGTTACTCCAATCGGCCAAGGGAATGAGCTTGCTTTGTCCC
ATGGTGATACTGTTGCTTTAGGCGATTATCAAATACTAATTAGTATTAGTGATATCCCTGAAGATAGGAC
AGAGCATCAATTTACATCTAAACCAGAGGTTAAGACGCCAGTTGAATTCGAACAGCACGTAGAATCGATT
CCAGAGGTGGAAGATTTTGGTTTAAGCGCTGCCGAGTTGATGGATGAAAGTGTCCCATCTGATTTTCAGT
TAGACATTGGTCTAGTAGATGATTTTCTAGAAATTCCGAGTCACGAAACTGAAGTGCCACAACCTAAAGT
TGCATCAATGCAGCCTGATACCAACGCTAAAAGTCAAAAACCTACAGTGCATCGAGGTGAACTGGAAGCC
TTCATTTATGGCATGGGGATCGACCCCAATATGGTACCAAGCCAAAATCGAGAGCAGTGGTTTGAACAAT
TAGGTCAGTCGTTTTCTCTCATGCTTATTGGGCTAATGGAGACTCTTCACAATCGGGCTGTATTTAAACA
AACCAATCGCGTCAACCATACTGCATTTAGAAAGTCTGAAAATAATCCACTTAAGTTTTCAGCAAATTTG
GAAGATGCAATCCACAATTTGTATAACCGTCAAACGTCAAGTTTTTTAAAGCCTAATGCCGCAATAAAAG
AAGCATTTAACGATATTGAAAATCATGAGCAGGCTTTAATGCAAGGAGTCGCGGGTACGGTATCGAGTGT
CATGTCTCTCGTTGAACCTAATACTATTTATTCAGATGCATTGGCTAAAGACAACGTAATTAATAAGGTT
ATTCCAGCAAGAAAATATGCTCAGAGTTGGAAGCGCTTTGAAGGTATTCATAGCCAATTAACAGATGAAC
TTGTTAATAAAGAGTCTCCATTTTATTTAGAAGATTTCGCTAAGCACTACGAATTAGCGCTCAAGAATAA
AGGTTAA
 Primer design