SecReT6
Protein ID: 436841892
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21896
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2290697..2294209 [+]
Productconserved membrane protein of unknown function
NoteTssM
UniProt IDL0RBN2
KEGG IDdhy:DESAM_21896
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.30E-50, Aligned region: 183..435
DUF1215 [PF06744], Evalue: 3.40E-05, Aligned region: 965..1015
Protein Sequence: 1170 a.a.     [Download]
>gi|436841892|ref|YP_007326270.1| conserved membrane protein of unknown function [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MKKLILQILKALFYVLLFVAAAVASYALVTYKGWPWWAGACLFGGVIGFVVAILFMRKWFLRRRERKFVK
RIVDQDDSAIAAAPVHERARLQDLQTRWMDAVELLRSSELRKRGNPLYVLPWYMVFGESDSGKTTAVASS
RLTTILTDVGPVPGVSATKNCDWWFFEEAIILDTAGRYAIPLDESRDKEEWERFLTLLVKYRKKEPLNGL
IVTVPADRLLGGDEDGLAEYGRSLRRRINELMRVLGVRFPVYVLITKMDLVFGLKGLTEVLPEYTHSQAM
GLVNETMMADPEEFVDKAILSVTERLRELRLLLLDSSSRFDPAFLLFSEELDRLRPRIKAFAVGAFEDNP
YQELPLFRGMFFSSGEQTGEQSSEFISGLSSLKNVEKKLPKTARGLFLHDFFSKILPRDRNLFTPILEFL
KWKLLTRNMGMGVWLLILFFLSGLFSLSYIANQRAMNDLFVAFPEKPVFSEKVDEKIVQIDGFRKKILDL
HNLNSDWWIPRMGLEVSNEAEFEIKKLYCQDVESLLLKPMDEQLDSAVNKLDVKSTEQLTSSFIKLLVWR
IDLIKNRLSTGTRKPLSDFELPSGRAMSTAIEGFNPDLMKYFGELYGSYLEWNDNTEGLSEQKMLLQARL
GKVFSLKGSDFKWLVDWINDNPELEPVTLQDFWGGPQLLLKNEIYVAPAYTQSGHKMLQGFLAELKDAMQ
DVGEFDKKEKAFWVWYAGEYYKIWFNFAEHFADGKKQLLTKNDYRDMAAKMALPNNPYFRLLTQMKDEFS
PIKKIITPPDWVNQVLYFNVVLAQYKASKAKGVEESSEKAQDSLRKIVAEFGGKIAQDVEQRIEVAKRLD
GYINVLDDVSAFTDTQEKAFKSAAALFPGSGGSPGGSSGGGSSGASGSAALKKNPVEGATQAMSALKAHM
NSEGRGSDMFWHLVAGPLDFIVYVIISEASCELQQLWEGQVLAEVAHVPSNKLRENLFGKTGVVNKFITG
TAKPFLSRDTKGWRSKVWMGIPFPFKDDFFTFLNDGARGSQEIQPEYKVTLSTLPTSVNTNATQEPYSTI
LTVECGSAQQVLSNFNYAEEMLFTWKPEDCGTTTLTIKFPGLSLTRSYDGKLGFAKFLGEFRGGVMTFTP
KDFPQQEKALIDLGVETVKVGYAFKGAAPVIELLDIKPLNIPDNISNCWQ
 
Nucleotide Sequence: 3513 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2290697-2294209 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGAAGAAACTAATTCTACAGATACTCAAGGCTCTCTTTTACGTGCTGCTTTTTGTCGCGGCAGCGGTGG
CCTCTTATGCACTGGTTACTTATAAAGGCTGGCCGTGGTGGGCCGGAGCTTGTCTTTTCGGCGGGGTTAT
CGGTTTTGTTGTTGCGATTCTTTTTATGCGTAAATGGTTTTTGCGTAGACGCGAAAGGAAATTTGTCAAG
CGTATTGTCGATCAGGATGATTCTGCCATTGCAGCAGCTCCGGTTCATGAAAGGGCACGTTTGCAGGATC
TGCAAACAAGGTGGATGGATGCTGTGGAACTTTTGCGTTCTTCAGAACTGCGTAAGCGTGGTAATCCGCT
TTATGTTTTGCCTTGGTATATGGTTTTTGGCGAGTCTGATTCTGGTAAAACCACAGCGGTGGCCAGCAGC
AGGCTGACTACTATTCTTACCGATGTAGGGCCTGTGCCGGGTGTTTCTGCTACCAAGAATTGCGACTGGT
GGTTTTTTGAAGAGGCTATAATTTTAGATACCGCAGGTCGCTATGCCATTCCGCTTGATGAGTCACGTGA
CAAAGAGGAATGGGAGAGATTTCTTACGCTTTTGGTTAAGTATCGTAAAAAAGAACCGCTTAACGGTTTG
ATTGTTACGGTCCCCGCTGACAGGCTGTTAGGCGGCGATGAAGACGGACTTGCCGAGTATGGACGCAGTC
TCAGACGGCGTATCAATGAGCTTATGCGTGTACTTGGGGTGCGTTTTCCGGTTTACGTGCTGATTACCAA
GATGGATCTTGTTTTCGGACTTAAAGGACTGACCGAAGTTCTGCCGGAATATACACACTCTCAGGCTATG
GGGCTGGTTAATGAAACTATGATGGCTGACCCTGAAGAGTTCGTGGATAAAGCCATACTCAGCGTAACAG
AGAGATTGCGTGAACTCAGGTTGCTTCTGCTTGACAGCAGCAGTCGTTTTGATCCCGCTTTTCTGCTTTT
TTCAGAGGAACTTGACCGTTTGCGTCCACGGATCAAGGCGTTTGCCGTCGGAGCCTTTGAAGACAATCCA
TATCAGGAACTGCCATTGTTTCGGGGGATGTTCTTTTCCAGTGGTGAACAGACCGGCGAACAGAGTTCAG
AATTTATCAGCGGACTTTCTTCACTTAAAAATGTTGAAAAAAAGTTGCCTAAAACTGCACGCGGTCTCTT
CCTGCATGACTTTTTTTCTAAAATACTGCCTCGCGACCGTAATTTATTCACGCCTATTCTTGAGTTTCTT
AAATGGAAGCTTTTGACCAGAAATATGGGAATGGGTGTCTGGCTGCTGATTCTGTTTTTTTTGAGCGGTC
TTTTCAGTCTGTCATATATCGCCAACCAGAGGGCTATGAATGATCTCTTTGTTGCTTTTCCGGAAAAACC
TGTTTTTTCGGAAAAGGTCGACGAGAAGATTGTTCAAATTGATGGATTCAGGAAGAAAATCCTTGATTTG
CACAATCTTAATTCTGACTGGTGGATTCCACGTATGGGCCTTGAGGTCAGTAATGAAGCTGAATTTGAAA
TAAAAAAATTGTACTGTCAGGACGTAGAATCTCTTCTTCTTAAGCCCATGGACGAACAGCTCGATTCAGC
TGTCAATAAACTGGATGTTAAATCTACGGAACAGCTTACCAGTTCTTTTATAAAACTTTTGGTCTGGCGG
ATTGATTTAATAAAAAATCGTTTAAGCACTGGAACAAGAAAGCCATTATCCGACTTTGAGCTTCCCTCGG
GCAGGGCTATGTCAACTGCGATAGAGGGATTCAACCCCGATTTGATGAAATATTTTGGTGAATTGTATGG
TTCATATCTTGAGTGGAATGATAATACCGAAGGTCTCTCTGAGCAGAAGATGTTATTACAGGCCCGGCTG
GGAAAAGTTTTCAGTCTCAAAGGTTCTGATTTCAAGTGGCTGGTGGATTGGATAAATGACAATCCCGAGC
TGGAGCCGGTTACTTTGCAGGATTTTTGGGGCGGTCCGCAATTGCTTTTGAAAAATGAAATATATGTCGC
TCCAGCGTATACTCAGTCCGGTCATAAAATGTTGCAGGGCTTTCTTGCTGAGCTTAAAGACGCGATGCAG
GATGTAGGTGAATTTGATAAAAAAGAAAAGGCCTTCTGGGTCTGGTATGCAGGTGAATATTATAAAATCT
GGTTTAACTTTGCAGAGCACTTTGCTGATGGCAAAAAACAGCTTCTGACCAAGAATGATTACCGTGACAT
GGCTGCTAAAATGGCATTGCCGAATAATCCTTATTTCCGTTTACTTACTCAGATGAAAGATGAATTCAGT
CCTATTAAAAAAATTATAACCCCTCCGGACTGGGTTAATCAGGTTTTATATTTTAATGTAGTTCTAGCGC
AATACAAGGCCAGCAAGGCCAAAGGTGTTGAAGAGTCCTCTGAGAAAGCTCAGGATTCACTTAGAAAAAT
AGTGGCCGAATTCGGTGGAAAAATAGCTCAGGATGTTGAACAGCGTATAGAAGTTGCTAAGAGGCTTGAT
GGTTATATTAACGTTCTTGATGATGTTTCCGCCTTTACTGATACGCAAGAAAAAGCCTTTAAGAGTGCCG
CGGCCCTTTTTCCCGGTTCAGGGGGAAGTCCGGGCGGTTCTTCCGGCGGAGGTTCAAGCGGGGCATCGGG
TAGTGCTGCGTTGAAAAAAAATCCTGTCGAAGGAGCAACTCAGGCAATGTCTGCGCTTAAAGCTCACATG
AACAGCGAAGGTCGCGGTTCCGATATGTTCTGGCATCTGGTTGCCGGTCCGCTTGATTTTATAGTCTATG
TAATCATATCCGAAGCTTCCTGTGAATTGCAGCAGTTGTGGGAAGGGCAGGTGCTTGCTGAGGTTGCGCA
TGTTCCAAGTAATAAGCTTAGGGAAAATCTTTTTGGCAAAACCGGAGTGGTAAATAAGTTTATTACTGGT
ACGGCCAAGCCTTTTCTGTCTCGCGATACCAAAGGATGGCGCAGTAAGGTCTGGATGGGCATCCCGTTTC
CGTTTAAGGATGACTTCTTTACTTTCTTAAATGACGGCGCACGCGGCAGTCAGGAGATTCAGCCCGAATA
CAAGGTCACCCTTTCCACCCTTCCGACTTCGGTAAATACCAATGCGACGCAGGAACCATATTCAACAATA
CTTACCGTGGAGTGCGGCAGTGCACAGCAGGTTTTGTCTAATTTCAACTATGCAGAGGAAATGCTTTTTA
CCTGGAAGCCGGAAGACTGCGGAACAACTACGCTGACAATCAAGTTTCCCGGACTCAGTCTTACCCGCAG
TTATGATGGAAAGCTTGGTTTTGCAAAGTTTCTTGGTGAATTCCGTGGCGGGGTAATGACATTTACTCCT
AAGGATTTTCCGCAGCAGGAGAAGGCTTTAATCGACCTTGGCGTAGAGACCGTGAAGGTTGGCTATGCTT
TCAAGGGAGCGGCTCCGGTCATCGAATTACTTGATATTAAACCCCTAAATATTCCTGACAACATTTCGAA
CTGCTGGCAATAA
 Primer design