SecReT6
Protein ID: 440230381
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1691
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1782713..1786132 [+]
Producthypothetical protein
NoteTssM
UniProt IDL0MDJ7
KEGG IDsmaf:D781_1691
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.60E-71, Aligned region: 415..733
DUF1215 [PF06744], Evalue: 3.20E-36, Aligned region: 856..976
Protein Sequence: 1139 a.a.     [Download]
>gi|440230381|ref|YP_007344174.1| hypothetical protein D781_1691 [Serratia marcescens FGI94]
MDNVNKPAVISVAATAAVCIAVTTLLVLLGGLAWWLWGSERATQWDALRPLIVAGFIVWGTALSLLMLGF
MAFRLLIKDKVSPSTSRKRQPTTASGRETAYVALKKHLRTRYGPFWRRKVHLLLVVGDAAAIEQLVPGLQ
AQRWLEGSRTVLIYGGGLASDPDREQLSALRRLRRGRPLDGVVRVLNTDQSLTPQLSDSDLRGLEKIGDL
LRYQPAVWLWQLCSSDWPQAGRQPQAVGITLPARGSADEAAARLGELLPQLRAQGLAQVAENRAFDFLLR
LAQRLEQGDGARWKNALTPWLYGAQRRVPLRGLMFSLPGAADAQVQGSKESAAAARHPHAVTFSDAWQGI
FDDRVRGRRVGMAWEQTLALAVMAGIGLWAVGMTISFVANRQQIVAVADKAQALVARPAVTDAQLGALHA
LRNDAGRLQQHSRAGAPWYQRFGLDHNPQLLAAMLPWYGVANNRLIRDPAGEALRQTLTQLVNSPPNSPQ
RIALAKPGYDRLKAWLMMARPDKVDAAFYAQTLQAVQPAPRGISPGLWQSLAPDLWAFYIAELAQQPGWK
ITPDAALVSQSRQVLLQQIGRRNAESTLYENMLKSVRRNFADLRLEDMTGGTDARRLFDSREVVPGMFTR
QAWEGGIQQAIEKAANARRDEIDWVLSDSSQGVAADISPEALKARLTQRYFTDFAGSWLGFLNGLHWQPA
NNIADVTDQLTLMSDVRQSPLIALMNTLAWQGQTGQKGKALSDSLLKSAKELLHSDSRPAIDQSAAGPVG
PLDEAFGPLLTLMGKNPAGQVMAANSTLSLQIYLTRITRVRLRLQQVASASDPQEKMQTLAQTVFQGKSV
DLTDTQQYGSLMAASLGEEWSGFGQTMFVQPLTQAWETVLQPSAASLNGKWRRAVVSNWQSAFDGRYPFA
ASKSEASLPMLAEFIRKDTGRIERFLAQELGGVLHKEGSRWVVDKTNSQGLNVNPAFLKAVNQLSQLSDI
LFTDGSQGIGFELQARPTPQVVETTLTIDGQKLRYFNQMAEWQTFRWPGETFKPGTMLTWSATNAGARLF
GDYGGTWGFIRWLEQGKRRQLDRSQWMMSFSAPGGRTLQWVLRSQLGIGPLALLALRGFTLPEQIFSVDA
TAATQALSSSDDPVMNGIE
 
Nucleotide Sequence: 3420 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1782713-1786132 Serratia marcescens FGI94, complete genome
ATGGACAACGTCAATAAACCTGCTGTCATCTCTGTGGCAGCCACGGCCGCCGTCTGTATTGCTGTGACCA
CGCTGCTGGTCCTGTTAGGCGGGCTGGCATGGTGGCTGTGGGGGAGCGAACGTGCTACGCAATGGGATGC
GTTGCGTCCGCTGATCGTTGCCGGTTTTATCGTCTGGGGAACGGCGCTCAGCCTGCTGATGCTGGGTTTT
ATGGCTTTCCGCTTGCTGATTAAGGACAAGGTTAGCCCGTCGACATCCCGTAAGCGTCAACCGACAACGG
CAAGTGGGCGAGAAACCGCATATGTCGCGCTGAAAAAACATCTCCGTACCCGCTACGGCCCTTTCTGGCG
GCGCAAAGTGCATCTGCTGCTGGTTGTCGGCGATGCTGCCGCTATTGAACAACTGGTTCCCGGCCTGCAG
GCTCAGCGCTGGCTCGAGGGCAGCCGCACCGTGCTGATTTACGGCGGTGGCCTGGCATCGGATCCCGACC
GCGAACAACTCTCCGCCCTGCGCAGGCTGCGCCGCGGCCGCCCGCTGGACGGGGTTGTCCGCGTGCTGAA
TACAGACCAGTCGCTGACGCCGCAGCTGAGTGATAGCGATCTGCGGGGGCTGGAAAAAATCGGCGACCTG
TTGCGTTACCAGCCGGCGGTCTGGCTGTGGCAGTTGTGCAGCAGCGATTGGCCGCAGGCGGGTCGGCAGC
CCCAGGCGGTAGGTATTACGCTGCCGGCGCGGGGCAGCGCGGACGAGGCGGCGGCCCGGCTCGGCGAGTT
GCTGCCGCAGCTGCGTGCACAGGGGCTTGCTCAGGTGGCGGAAAACCGGGCCTTTGATTTTCTGCTGCGT
CTGGCGCAGCGGTTGGAGCAGGGCGACGGCGCGCGCTGGAAAAATGCGCTGACGCCGTGGCTGTACGGCG
CCCAGCGGCGCGTGCCGCTGCGCGGCCTGATGTTCAGCCTGCCGGGTGCGGCTGACGCACAGGTTCAAGG
GAGCAAAGAGAGTGCCGCAGCGGCGAGGCATCCGCATGCCGTTACCTTCTCGGACGCCTGGCAGGGCATC
TTTGATGACCGCGTCCGCGGCCGCCGGGTCGGCATGGCCTGGGAACAGACGCTGGCGCTGGCGGTGATGG
CCGGCATCGGGCTGTGGGCCGTGGGGATGACGATCTCCTTCGTCGCCAACCGCCAGCAAATTGTCGCGGT
GGCGGACAAGGCGCAGGCGCTGGTCGCCCGGCCGGCGGTGACGGATGCGCAGCTCGGCGCTCTGCATGCG
CTGCGCAACGACGCCGGCCGTCTGCAGCAGCATAGCCGCGCAGGCGCGCCCTGGTATCAGCGTTTCGGGC
TGGATCACAATCCGCAGCTGCTGGCCGCGATGCTGCCCTGGTACGGCGTGGCGAATAACCGTTTGATCCG
CGATCCGGCCGGCGAGGCGCTGCGGCAAACGCTGACCCAACTGGTGAATTCGCCGCCCAACAGCCCACAG
CGCATCGCGCTGGCCAAACCCGGTTACGATCGGCTGAAAGCCTGGCTGATGATGGCGCGCCCGGATAAGG
TTGACGCCGCTTTCTATGCGCAAACCCTGCAGGCGGTGCAGCCTGCGCCCCGGGGCATCTCCCCCGGGCT
GTGGCAGAGCCTGGCGCCGGACCTGTGGGCGTTCTATATCGCCGAGCTGGCTCAGCAGCCCGGCTGGAAA
ATTACCCCGGATGCGGCGCTGGTCAGCCAGAGCCGTCAGGTGCTGTTGCAGCAGATCGGGCGTCGCAACG
CTGAAAGTACGCTGTATGAGAATATGCTCAAATCGGTGCGCCGTAACTTTGCCGATCTGCGGCTGGAAGA
TATGACCGGCGGCACCGATGCCCGGCGGCTGTTCGACAGCCGGGAGGTGGTGCCGGGAATGTTCACCCGT
CAGGCCTGGGAAGGGGGCATTCAGCAGGCGATAGAGAAGGCGGCCAACGCCCGGCGCGATGAGATCGACT
GGGTGCTGAGCGACAGCAGCCAGGGCGTCGCGGCGGATATCTCGCCGGAAGCGCTGAAGGCCCGCCTGAC
GCAGCGTTACTTCACGGATTTTGCCGGCAGCTGGCTCGGTTTCCTCAACGGTCTGCACTGGCAGCCGGCC
AACAACATTGCCGATGTGACCGACCAGCTGACGCTGATGAGCGACGTACGGCAGTCGCCGCTGATTGCCC
TGATGAATACGCTGGCCTGGCAGGGGCAAACCGGGCAGAAGGGCAAGGCGCTGTCCGATTCGCTGCTCAA
ATCGGCGAAAGAGCTGCTCCACAGCGACAGCCGGCCGGCCATCGATCAGAGCGCGGCCGGGCCGGTTGGC
CCGCTGGATGAGGCTTTCGGCCCGCTGCTGACCCTGATGGGCAAAAATCCGGCCGGTCAGGTGATGGCGG
CCAACAGTACCCTCAGCCTGCAAATCTACCTGACCCGCATTACCCGCGTACGGTTACGGCTGCAGCAGGT
GGCCAGCGCTTCAGACCCGCAGGAAAAAATGCAGACGCTGGCGCAGACGGTATTTCAGGGCAAAAGCGTC
GATCTGACCGACACCCAGCAGTACGGCAGCCTGATGGCCGCCAGCCTCGGCGAGGAGTGGAGCGGCTTTG
GGCAGACGATGTTCGTCCAGCCGCTGACGCAAGCCTGGGAAACCGTGCTGCAGCCGTCCGCCGCCAGCCT
GAACGGCAAGTGGCGCAGGGCGGTGGTCAGCAACTGGCAGAGCGCCTTCGACGGCCGCTATCCGTTCGCC
GCCAGTAAAAGTGAGGCTTCGCTGCCGATGCTGGCGGAGTTTATCCGCAAGGATACCGGCCGCATTGAAC
GTTTTCTGGCGCAGGAGCTGGGCGGCGTGCTGCACAAAGAGGGCAGCCGGTGGGTGGTGGATAAAACCAA
CAGCCAGGGGCTGAACGTTAACCCGGCGTTTCTGAAGGCCGTCAACCAGCTCAGCCAGCTGTCGGACATT
CTGTTTACCGACGGCAGCCAGGGGATCGGCTTTGAACTGCAGGCGCGTCCGACGCCTCAGGTGGTGGAAA
CCACGCTGACCATTGACGGCCAGAAACTGCGTTACTTCAACCAGATGGCGGAATGGCAGACTTTCCGCTG
GCCGGGAGAGACCTTTAAGCCGGGCACCATGCTGACCTGGAGCGCCACCAACGCCGGCGCCCGATTGTTT
GGCGACTACGGCGGCACCTGGGGCTTTATCCGCTGGCTGGAGCAGGGCAAGCGGCGCCAGCTCGATCGCA
GCCAGTGGATGATGAGCTTCAGCGCGCCGGGTGGCCGCACGCTGCAGTGGGTGCTGCGTTCACAGCTGGG
CATTGGCCCGCTGGCGCTGCTGGCGTTACGCGGTTTCACGCTTCCAGAGCAGATATTCAGTGTGGATGCC
ACAGCGGCAACACAAGCGCTGAGTTCTAGCGATGATCCGGTTATGAATGGAATTGAATAA
 Primer design