SecReT6
Protein ID: 440231417
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2774
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2921809..2925453 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDL0MJV5
KEGG IDsmaf:D781_2774
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.40E-102, Aligned region: 208..489
IcmF-related [PF06761], Evalue: 1.00E-86, Aligned region: 537..844
DUF1215 [PF06744], Evalue: 1.30E-32, Aligned region: 955..1080
Protein Sequence: 1214 a.a.     [Download]
>gi|440231417|ref|YP_007345210.1| type VI secretion protein IcmF [Serratia marcescens FGI94]
MLSTLFSIITSRLLWGFAGISALAFIIWMIGPLVAIGDYRPLEPELNRIITIAVIYLIWVLCRIVPRIYS
AWFNRKLLSNLRASEQTPADDADAKAEPQQDQLLAQRFDEAAQLLKKARFAPGQGDKHRWMTRFSRQYLY
QLPWYVIIGAPGAGKTTALVNSGLHFPLADRFGKSALRGVGGTRNCDWWFTNDAVLLDTAGRYTTQESQR
EEDAGEWKSFVNLLKKYRTRQPINGVMVTISVADLMTESAEARNAQASALRKRLIELHEQLGIHFPVYVM
VTKTDLLNGFMAYFSGFDKAQRDQIWGFTFPYERSRQSDFNLSGEFEQQYTLLQQRLDAALPDTLLVEHD
ARQRSESYLFPQEFAALRPLLAQYLDVVFATSSFETRFTPRGIYFTSGTQEGLPFDRVMGELNRYLQLPS
NGTQSNGGQTSWDSVNDEAPIPAAKGQSFFLKETLESVIFQESGLAGSNRWWEYRNRALHWAGYIGLALV
LTILGIFWFTSYGNNKAYLAEVSAKAPSVERQGQGLTQLDSGDMFALLPFLNSVLHLPDSQNFSLDDPPF
TYRMGLYRGDQVSDASNALYQKTLKELLLPQVAQQIATTLRNDNHGDADFSYEALKAYQMLYLPKQYDGK
FLRAWVMLNLQRNLPQGSTKKQLQQLEWHLSQLLDGQIQASPYARDEALVTQAQAAINRAPLSQRVYGRL
KRLLLNQTEIKPVRLVDLASPQTELAFSRKSGKPVTDGIPGLFTPQGYWKAFDSNIDKVTDTLRQEDVWV
LNTQTPEQKSADLTKTVRQLYMQDFIDVWDELLGDIQLAHIGNLTQRISSARLLSGNPSPMRNLLVNVGK
NVTLREEKDGEEARSLADKAGESINQSANRTLEALFTNRTNNADGDVSTQPEQVVMAHFAPLLELTQGQG
EGSKAIVFDGVLKQVDELYSYLTAVQGAANSGMSAPPSDVIPRLQAESGRLPTPFKQMLLSLAIGASSDT
QRKEMENVKKRISFEVGSFCRQAIAGRYPLSSRSQRDVTPDDLARMFAPNSGLMDSFFRENLQGKVDTTR
ANWRFTPGVDGKTLPGGEGILRSFQQAQRIRDAFFANGTATPSYRVTVRPVRMDNDILNMTLDIDGQLFK
YSHGPLVPLVVSWPGTRNTNQVHLQLALANGTTASRLTSGPWALNRMVDMASLSAGGSSLSRQATFNLDG
HRVTLEFTANSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3645 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2921809-2925453 Serratia marcescens FGI94, complete genome
ATGCTTAGTACGTTATTCTCCATCATCACCAGCCGCCTGTTATGGGGGTTTGCCGGCATCAGCGCCCTGG
CGTTCATCATCTGGATGATCGGCCCGCTGGTGGCCATCGGCGATTACCGTCCGCTGGAGCCGGAACTGAA
CCGCATCATCACCATTGCGGTAATCTACCTGATTTGGGTACTGTGCCGCATTGTGCCGCGCATCTACAGC
GCCTGGTTTAACCGCAAGCTGCTCAGCAACCTGCGCGCCAGCGAGCAGACGCCGGCCGATGACGCCGACG
CCAAGGCGGAGCCACAGCAGGATCAGCTGCTGGCGCAGCGCTTTGACGAGGCCGCCCAACTGCTGAAAAA
GGCGCGCTTTGCGCCCGGTCAGGGCGATAAACACCGCTGGATGACCCGCTTCAGCCGCCAGTATCTGTAT
CAACTGCCCTGGTACGTGATTATCGGCGCGCCGGGCGCCGGCAAGACCACCGCGCTGGTGAACTCCGGCC
TGCACTTCCCGCTGGCGGACCGCTTTGGCAAATCCGCGCTGCGCGGCGTCGGCGGCACCCGCAACTGCGA
CTGGTGGTTCACCAACGACGCCGTGCTGCTGGACACCGCCGGCCGTTACACCACTCAGGAGAGCCAGCGG
GAAGAAGACGCCGGCGAGTGGAAAAGCTTCGTCAACCTGCTGAAAAAGTACCGCACCCGCCAGCCGATTA
ACGGCGTGATGGTGACCATCAGCGTCGCCGATCTGATGACGGAAAGCGCCGAAGCGCGCAACGCGCAGGC
CAGCGCGCTGCGTAAGCGACTGATTGAACTGCACGAACAGCTGGGCATCCACTTCCCGGTTTACGTGATG
GTGACCAAAACCGACCTGCTCAACGGCTTTATGGCCTACTTCAGCGGCTTTGACAAAGCGCAGCGCGACC
AGATCTGGGGGTTCACCTTCCCGTATGAGCGCTCACGTCAGTCCGACTTTAACCTCAGCGGCGAATTTGA
GCAGCAGTATACGCTGCTGCAACAGCGTCTCGACGCGGCGCTGCCGGATACGCTGCTGGTCGAGCACGAT
GCGCGCCAGCGCTCAGAGAGCTATCTGTTCCCGCAGGAGTTCGCCGCACTGCGTCCGCTGCTGGCGCAGT
ACCTGGACGTGGTGTTCGCCACCTCCAGCTTTGAAACACGCTTCACGCCGCGCGGCATTTACTTTACCAG
CGGCACCCAGGAAGGCCTGCCGTTCGACCGGGTGATGGGCGAGCTGAACCGCTATCTGCAGCTGCCGTCC
AACGGCACACAAAGCAACGGCGGCCAGACCTCCTGGGACAGCGTCAACGACGAGGCGCCTATCCCGGCGG
CCAAAGGGCAGAGCTTCTTCCTGAAAGAGACGCTGGAATCGGTGATCTTCCAGGAGTCCGGGCTAGCCGG
CAGCAACCGCTGGTGGGAATACCGCAACCGCGCGCTGCACTGGGCCGGCTATATCGGCCTGGCGCTGGTG
CTGACGATTCTGGGAATTTTCTGGTTCACCAGCTACGGCAACAACAAGGCCTACCTGGCCGAAGTCTCCG
CCAAGGCGCCGTCCGTGGAGCGTCAGGGCCAAGGACTGACGCAGCTGGACTCCGGCGATATGTTCGCCCT
GCTGCCGTTCCTGAACAGCGTGCTGCATCTGCCGGACAGCCAGAACTTCTCGCTGGACGATCCACCGTTT
ACTTACCGGATGGGGCTGTATCGCGGCGACCAGGTCAGCGACGCCAGCAACGCGCTGTACCAGAAAACGC
TGAAAGAGCTGCTGTTGCCGCAGGTGGCGCAGCAGATCGCCACCACCCTGCGCAACGATAACCACGGCGA
TGCCGACTTCAGCTACGAAGCGCTGAAGGCTTACCAGATGCTGTATCTGCCGAAGCAGTACGACGGCAAA
TTCCTGCGCGCCTGGGTGATGCTCAACCTGCAGCGCAACCTGCCGCAGGGCAGTACCAAAAAACAGTTAC
AGCAATTGGAATGGCACCTGAGCCAACTGCTTGACGGCCAGATTCAGGCATCGCCTTACGCCAGGGACGA
AGCGCTGGTCACCCAGGCGCAGGCCGCCATCAACCGCGCGCCGCTGTCGCAGCGCGTCTATGGCCGCCTG
AAGCGCCTGCTGCTGAATCAGACCGAGATTAAACCGGTGCGTCTGGTGGATCTCGCCAGCCCGCAGACCG
AGCTGGCGTTCTCGCGCAAAAGCGGCAAGCCGGTCACCGACGGCATCCCGGGCCTGTTTACCCCGCAGGG
ATACTGGAAGGCGTTCGACAGCAATATCGATAAAGTGACCGATACGCTGCGTCAGGAAGATGTCTGGGTG
CTGAACACCCAGACGCCGGAGCAGAAAAGCGCCGACCTGACCAAGACCGTACGCCAGCTTTATATGCAGG
ATTTTATCGACGTCTGGGATGAGCTGCTGGGGGATATTCAGCTGGCCCATATCGGCAATCTGACGCAGCG
CATCAGCAGCGCACGCCTGCTGTCCGGCAATCCGTCGCCGATGCGCAACCTGCTGGTCAACGTCGGTAAA
AACGTTACGCTGCGGGAAGAAAAAGACGGTGAGGAAGCACGTTCGCTGGCGGATAAGGCCGGCGAATCCA
TCAACCAGAGCGCCAACCGTACGCTGGAGGCCCTGTTCACCAACCGGACGAACAACGCCGACGGCGACGT
CTCCACCCAGCCGGAACAGGTGGTGATGGCGCACTTCGCGCCGCTGCTGGAGTTGACGCAGGGTCAGGGC
GAAGGCAGCAAGGCGATTGTGTTTGACGGCGTGCTGAAACAGGTCGATGAGCTGTACAGCTATCTGACTG
CGGTGCAGGGCGCGGCCAATAGCGGCATGTCCGCACCGCCGAGCGACGTGATCCCGCGCCTGCAGGCGGA
GTCCGGCCGTTTGCCGACGCCGTTCAAACAGATGTTGTTGTCACTGGCGATCGGCGCCAGCAGCGATACC
CAGCGTAAGGAGATGGAGAACGTAAAAAAGCGCATCAGCTTTGAGGTCGGCAGCTTCTGCCGGCAGGCGA
TAGCTGGCCGCTATCCCCTCTCCTCGCGCTCGCAGCGGGACGTAACGCCGGACGATCTGGCGCGCATGTT
CGCCCCCAACAGCGGGCTGATGGACAGCTTCTTCCGCGAGAATCTGCAGGGCAAAGTAGACACCACCCGC
GCCAACTGGCGTTTCACGCCGGGCGTCGATGGTAAAACCCTGCCGGGCGGCGAAGGTATTCTGCGTTCGT
TTCAGCAGGCGCAGCGCATTCGCGATGCGTTTTTTGCCAACGGCACCGCCACGCCGTCTTACCGCGTGAC
GGTAAGGCCGGTGCGGATGGATAACGATATTCTCAATATGACGCTGGATATTGACGGGCAGCTGTTCAAA
TACAGCCATGGTCCGCTGGTGCCGCTGGTGGTCAGTTGGCCAGGCACCCGCAACACCAATCAGGTACACC
TGCAGCTGGCGCTGGCGAACGGCACCACCGCCAGCCGGCTGACCAGCGGCCCCTGGGCGCTGAACCGGAT
GGTCGATATGGCAAGTCTGTCGGCCGGCGGCAGCAGCCTGAGCCGTCAGGCGACGTTCAACCTCGACGGC
CATCGCGTCACGCTGGAATTCACCGCCAACAGTATCCGCAATCCGTTCCAGCTGCCGGCATTCTCCTGCC
CGTAG
 Primer design