SecReT6
Protein ID: 440288985
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3646
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3787730..3791251 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDL0M9Y5
KEGG IDebf:D782_3646
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.10E-85, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 5.10E-62, Aligned region: 204..454
DUF1215 [PF06744], Evalue: 1.10E-34, Aligned region: 305..320
DUF1215 [PF06744], Evalue: 1.10E-34, Aligned region: 914..1032
AAA_22 [PF13401], Evalue: 1.50E-05, Aligned region: 140..273
AAA_22 [PF13401], Evalue: 1.50E-05, Aligned region: 856..887
Protein Sequence: 1173 a.a.     [Download]
>gi|440288985|ref|YP_007341750.1| type VI secretion protein IcmF [Enterobacteriaceae bacterium strain FGI 57]
MFRLTTPRIFSSLRTMLRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYGEHWLKPLTNRWLATAA
WGIIALVWLTVRVIKRLQQLEKQQKQQREEAVDPLSVELNAQQRYLDRWLLRLQHHLDNRRYLWQLPWYM
VIGPAGSGKTALLREGFPSDIIYSPEVVRGAEQRLYLIPHVGQQAVIFDIDGTLCEQPDADVLHRRLWEH
ALDWLAEKRTRQPLNGLILTLDLPDLLTTDKRRREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLHG
FATLFQSLEKKDRDAILGVTFTRRAHENEDWRSELDTFWQTWCDRMNQALPDLMLAQSHMRSSLFSFARQ
MQGSREYLMTLLDGLLDGENMDVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNSPLTAWPLVDTTPYF
TRNLFPQALLAEPNLAGESRTWLVSSRRRLTVFSATGGVAALMLITGWHHYYKTNYASGVQVLKQAKAFM
DITPPQGIDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGLRVGPYVEQTYLQLLEQRYLPALF
NGLVKEMNAAPPESEEKLAVLRVMRMLEDKSGRNNEAVKQYMAKRWSEQFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDGDAISRWTPYDKPVVAAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQV
FTSADDSKLIVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTQSVKYSDADRAEIQRQLTEQYFSDY
TATWRAGMDNLNVRDYESIAQLTGALEQVISGDQPLQRALTALRDNTQPAILSDKLDDKAREEAQAEPDY
RLLTRLGHEFAPENSTLAVQKDKESMMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVHYMEVDWRDNVVKPFNEQLAGNYPFNPRATQDASLD
AFERFFKPEGLLDTFYQQNLKLFIENDLSRDGDDGVIIREDIIQQLENAQKIRDIFFSKQNGLGTQFAVE
TVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGGAPRSLSFSGPWAQFRL
FGAGQLTGVQDGNFTVRFSVDGGAMVYRVHTDTEDNPFSGGLFSLFKLPDTLY
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3787730-3791251 Enterobacteriaceae bacterium strain FGI 57, complete genome
GTGTTCAGATTAACGACACCCCGTATTTTTTCCAGTCTGAGGACCATGCTCAGACCGGCGATGCCCCGGT
TTAAGGTTTCTGCCTTCTGGCTGCTGATACTGGCATGGATTTTTCTGCTGGTATGGATCTGGTGGAAAGG
CCCGACCTGGACATTGTACGGAGAGCACTGGCTCAAGCCACTGACAAACCGCTGGCTGGCGACGGCAGCG
TGGGGGATTATCGCTCTGGTATGGCTTACCGTCCGGGTGATAAAGCGTCTGCAACAGCTTGAAAAACAGC
AAAAGCAACAGCGTGAGGAAGCCGTTGATCCACTCAGCGTGGAGCTGAATGCCCAGCAGCGTTACCTTGA
TCGCTGGCTGCTGCGTCTGCAACACCATCTCGACAACCGCCGTTATCTGTGGCAGCTCCCCTGGTATATG
GTTATCGGTCCGGCTGGCAGCGGTAAAACGGCGCTGCTGCGCGAGGGTTTTCCGTCTGACATTATTTATT
CCCCTGAGGTGGTCCGTGGCGCGGAGCAGCGCCTGTATCTCATCCCGCACGTCGGGCAACAGGCGGTCAT
ATTTGATATTGATGGCACACTTTGCGAACAGCCGGATGCCGATGTACTGCACCGCCGGTTATGGGAACAC
GCCCTGGACTGGCTGGCGGAGAAACGCACCCGCCAGCCACTGAACGGACTTATTCTGACACTTGATTTAC
CTGACCTGCTGACCACCGACAAACGCCGCCGCGAGCATCTGTTACAGACGCTGCGCAGCCGTTTGCAGGA
TATCCGCCAGCATCTTCACTGCCAGTTACCGGTCTATGTGGTACTGACACGACTGGATCTGCTGCATGGT
TTTGCCACGCTGTTTCAGTCACTGGAGAAAAAAGATCGCGATGCCATTCTGGGTGTCACATTTACCCGTC
GCGCCCATGAAAATGAAGACTGGAGAAGTGAACTCGATACCTTCTGGCAAACCTGGTGCGACAGGATGAA
CCAGGCGCTGCCGGATCTGATGCTGGCACAGAGTCACATGCGCAGCTCCCTGTTCAGCTTTGCCCGCCAG
ATGCAGGGAAGCCGGGAATACCTGATGACGCTGCTGGATGGTTTGCTTGACGGCGAAAATATGGACGTCA
TGTTGCGTGGCGTCTATCTCACCTCATCACTGCAACGTGGTCAGATGGATGATATTTTTACACAATCGGC
TGCCCGGCAATACCGACTGGGCAACAGCCCGCTGACGGCCTGGCCGCTGGTCGATACCACGCCTTATTTC
ACCCGCAATTTGTTTCCCCAGGCGTTACTGGCCGAACCGAATCTGGCCGGAGAAAGTCGTACCTGGCTGG
TGAGTAGCCGTCGCCGCCTGACTGTCTTTTCCGCAACGGGCGGCGTGGCGGCGCTGATGCTCATCACCGG
CTGGCACCATTATTACAAAACTAACTATGCTTCCGGCGTCCAGGTGCTTAAACAGGCCAAAGCGTTTATG
GATATCACGCCGCCTCAGGGAATAGACGACTACGGTAACCTGCAACTGCCGCTGCTGAACCCGGTGCGTG
ACGCCACTCTGGCCTACGGCGACTGGGGCGACCGCAGCCGCCTGGCGGATATGGGTCTGTATCAGGGGCT
GCGTGTCGGGCCGTATGTGGAGCAAACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCTGCCCTGTTT
AACGGGCTGGTCAAAGAGATGAACGCCGCGCCCCCGGAAAGCGAGGAAAAACTTGCTGTGCTGCGTGTGA
TGCGAATGCTGGAAGATAAAAGCGGGCGGAACAATGAGGCTGTGAAGCAGTATATGGCGAAACGCTGGAG
CGAACAATTCCACGGCCAGCGCGATATCCAGGCGCAACTGATGTCCCATCTTGATTACGCCCTCGCCCAT
ACTGACTGGCACGCAGAGCGCCAGGCTGGAGACGGTGACGCCATCAGTCGCTGGACGCCGTATGACAAGC
CCGTTGTGGCAGCACAGAAAGAACTGAGCAAGTTGCCGGTTTACCAGCGTGTTTACCAGAGCCTGAAAAC
ACGGGCGCTGGGTGTACTGCCCGCCGACCTCAATCTGCGCGACCAGGTGGGACCGACCTTTGACCAGGTG
TTTACGTCTGCCGATGACAGCAAACTTATCGTCCCGCAGTTTCTTACCCGCTATGGCTTACAGAGCTACT
TTGTGAAGCAGCGCGATGAACTGGTGGAGCTGACGGCAATGGATTCCTGGGTACTGAACCTGACACAAAG
CGTGAAATACAGTGACGCTGACCGTGCAGAGATCCAGCGCCAGCTCACCGAACAGTATTTCAGTGATTAT
ACAGCCACCTGGCGGGCAGGAATGGATAATCTTAACGTCCGGGATTATGAGTCCATTGCACAGTTGACCG
GCGCACTGGAGCAGGTTATCAGTGGAGATCAGCCTTTGCAGCGGGCGCTGACCGCCCTGCGGGATAACAC
ACAACCTGCGATACTATCCGACAAACTGGATGATAAAGCCCGAGAAGAAGCACAGGCAGAACCGGATTAC
CGCCTGCTGACCCGCCTCGGCCATGAGTTCGCGCCAGAAAACAGCACACTGGCGGTTCAGAAAGATAAAG
AAAGCATGATGCAGGCAGTGTATCAGCAGTTAACAGAACTGCACCGCTACCTGCTGGCGATCCAGAATGC
GCCTGTACCGGGAAAATCGGCGCTGAAAGCCGTCCAGTTACGCCTTGACCAGAACAGCAGCGATCCTATC
TTTGCCACCCGCCAGATGGCGAAAACCCTGCCCGCGCCACTTAACCGCTGGGTGGGAAAACTGGCCGATC
AAGCCTGGCATGTGGTGATGGTGGAAGCCGTTCACTATATGGAAGTGGACTGGCGTGACAATGTGGTGAA
ACCGTTCAATGAACAGCTTGCCGGTAACTATCCGTTTAATCCGCGTGCGACACAGGATGCCTCGCTGGAT
GCCTTCGAACGCTTCTTCAAACCAGAGGGCTTGCTGGATACTTTCTATCAGCAGAATCTGAAACTGTTTA
TCGAAAATGATCTGAGCCGTGATGGCGATGACGGGGTGATTATCCGCGAGGATATTATTCAGCAACTTGA
AAACGCACAGAAAATTCGCGACATCTTCTTCAGCAAACAAAATGGCCTGGGAACACAGTTTGCGGTGGAA
ACAGTCTCACTTTCCGGTAACAAACGCCGCAGCGTGCTGAACCTCGACGGCCAGTTAGTGGACTACAGCC
AGGGTCGTAATTATACCGCCCATCTGGTATGGCCGAACAATATGCGGGAAGGTAATGAAAGCAAACTGAC
ACTGATTGGAACCAGTGGCGGAGCACCGCGCAGCCTCAGCTTCAGCGGCCCGTGGGCGCAGTTCCGCCTG
TTCGGAGCCGGACAGCTAACCGGGGTACAGGACGGCAACTTTACCGTACGCTTTAGCGTGGACGGTGGCG
CAATGGTGTATCGAGTACACACTGACACTGAAGACAACCCGTTCAGCGGTGGGCTGTTCAGCTTATTTAA
GCTGCCAGATACATTGTACTGA
 Primer design