SecReT6
Protein ID: 442320143
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03166
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]3998997..4002881 [-]
Producthypothetical protein
NoteTssM
UniProt IDL7U9H0
KEGG IDmsd:MYSTI_03166
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 1.10E-14, Aligned region: 1039..1150
AAA_16 [PF13191], Evalue: 0.0027, Aligned region: 93..192
AAA_16 [PF13191], Evalue: 0.0027, Aligned region: 682..703
PepSY_TM_2 [PF13703], Evalue: 0.0091, Aligned region: 27..70
Protein Sequence: 1294 a.a.     [Download]
>gi|442320143|ref|YP_007360164.1| hypothetical protein MYSTI_03166 [Myxococcus stipitatus DSM 14675]
MAGEKVAAAATASAAANAATTAAEAARPYLTWILIGLGVLLALALVVGLVWWWRKRRPAAPAAEPRKKLE
SKALLRIQEKFLRALPLRYRVAVMDFPTVVVMGPAGAGKTTLIDLEVDWRRQERQFMPSYTSDPLLQIFL
GPDKVVHEVSASLLEDDTQEARSALRRLWRSSFRRQRGRVVVALDTRWLAETPPDEVRRFIQLVRGKINL
LGEVSKGAVETRLCLTHMDSLVGFEDFAQLLRGHGIPLHWDVPPPGEEGKLAAGLQPLEQYFALGLVSLS
VEAFGRLEEFYARGGDSFAALARFVSGLWEGGALSYRPELSRVYLSSPYAEARSMGVFAIAAEKRNIELR
SLYRGKHLRRCAALLALGCLPVLAAYANFHGRLEAAQRHMADFDSTVQRLQQQHLTASGEVVVDKGQGAM
QAMDALLAAKRFWPPLNHSFLDEQEVLRAQLANTVRLSYLKPLMERCQEQCERCGPLIPGCSPSELGGGR
SLFTPTQVDERCERETLCRPEQMLHLMAVARSARGDDMGRFLLSSLDSQYRKRWNWAADSLDLLGTRATG
KDGDWMQATGLREEVVGDYIISSDQAWRAGMQTQAQVPWMKWPYQWLREESYLGPWRDHLMRLQLVLGAR
ELNLEQWRTLASERQRLQITLAQSISYTSAHKLLALLDASGSPESQATLKGVENTLDSLDWHRDHQAMLA
AVLRMEEEIDAGLKAAEEMSTAELLTRTGGLFVPANADARIEVRVLQQSFEFRPKELSRVLLDKLLRQIE
QGQNPFSRRLLGLPSGVVASAQENGLGISIGDTLDVGHVDAMPSNHGSEWLNFETDIRPLVDEFTIRMTD
SKLSRAEAAQRQGYVLKKVSNFGQRYRQDLLVKYRDYRFTALTTTLASELSAVTQPTSELVAMLRDVSTG
AGIGPMEGPYYEPLRQELSAFRPVVQLMTPDKDGQTKELSSFLLLVSQLHTEVSGFNAPPMLSDRTVVPA
AMRTGGPDAPAAAEESGRQLVDLLSPLGRVGLSMLLDEEGSYLRKVDAWLDKQGILGELRRPFREPFLVT
RELGRAELERVLEEQWEWRFRTLLTPLMRRYPFAVEASQELDPTELDVLKRKDGAFWQFVNQVLSPVVEE
RGTEWMLRRPLRQQLAVPPRMLAMLSRLSKLARLLWTEEGKPKPLMLQVRPLPLPPSGDSGFVTMSFLKC
GEAASFGFNQTPAWQDFALAWWEPRSASVGVELRVPGREGKRYRSTELSRSSWNCFRILDAATFDAEQNA
IWPLPGPDGSEHSEIRLRFGMRGGPWTLFQEVTR
 
Nucleotide Sequence: 3885 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4002881-3998997 Myxococcus stipitatus DSM 14675, complete genome
ATGGCGGGCGAGAAGGTTGCGGCCGCGGCGACCGCGAGTGCGGCCGCGAACGCGGCGACGACGGCGGCGG
AAGCAGCGCGCCCCTATCTGACGTGGATTCTCATCGGGCTGGGGGTGCTGCTGGCCCTGGCGCTGGTGGT
GGGCCTGGTGTGGTGGTGGCGCAAGCGCCGGCCGGCCGCGCCCGCCGCGGAGCCTCGCAAGAAGCTGGAG
TCCAAGGCGCTGCTGCGCATCCAGGAGAAGTTCCTGCGCGCGCTGCCCCTGCGCTACCGCGTGGCGGTGA
TGGACTTCCCCACCGTGGTGGTGATGGGCCCCGCGGGAGCCGGCAAGACGACGCTCATCGACCTGGAGGT
GGACTGGCGCAGGCAGGAGCGCCAGTTCATGCCCAGCTACACGTCGGACCCGCTGCTGCAGATCTTCCTC
GGGCCCGACAAGGTGGTGCACGAGGTCTCCGCGTCGCTGCTGGAGGACGACACGCAGGAGGCGCGCAGTG
CGCTGCGGCGCCTGTGGCGCTCGAGCTTCCGGCGTCAGCGCGGGCGCGTCGTCGTGGCGCTGGACACGCG
CTGGTTGGCGGAGACGCCGCCGGACGAGGTGCGCCGCTTCATCCAGCTGGTGCGCGGGAAGATCAACCTG
CTGGGCGAGGTGAGCAAGGGCGCCGTCGAGACGCGGCTGTGCCTGACGCACATGGACTCGCTGGTGGGCT
TCGAGGACTTCGCCCAGCTCCTGCGCGGCCATGGCATCCCCCTGCACTGGGACGTGCCGCCTCCGGGGGA
GGAAGGCAAGCTGGCCGCGGGACTCCAGCCGCTGGAGCAGTACTTCGCGCTGGGCCTGGTGTCGCTGTCG
GTGGAGGCCTTCGGGCGGCTGGAGGAGTTCTACGCGCGGGGCGGTGACTCCTTCGCGGCGCTCGCGCGCT
TCGTCAGCGGCCTGTGGGAGGGCGGCGCGCTGTCCTACCGCCCGGAGCTGTCGCGGGTGTACCTGTCGTC
CCCCTACGCCGAGGCCCGCTCGATGGGGGTGTTCGCCATCGCGGCGGAGAAGCGGAACATCGAGCTGCGC
TCGCTCTATCGCGGCAAGCACCTGCGCCGCTGCGCGGCCCTGCTGGCGCTGGGGTGTCTGCCCGTGCTCG
CCGCGTATGCGAACTTCCACGGCCGGCTCGAAGCAGCCCAGCGGCACATGGCGGACTTCGACTCCACGGT
GCAGCGGCTCCAGCAGCAGCACCTGACGGCCTCGGGCGAGGTCGTGGTGGACAAGGGCCAGGGCGCGATG
CAGGCCATGGACGCGCTCCTCGCCGCCAAGCGCTTCTGGCCTCCGCTGAACCACAGCTTCCTCGACGAGC
AGGAGGTGCTCCGCGCGCAGCTGGCCAACACCGTCCGGCTCTCGTACCTCAAGCCCCTCATGGAGCGGTG
CCAGGAGCAGTGTGAGCGCTGCGGTCCGCTCATCCCCGGCTGTTCGCCGTCGGAGCTGGGAGGAGGCCGC
TCCCTCTTCACGCCCACGCAGGTGGACGAGCGGTGTGAGCGGGAGACGCTCTGCCGCCCCGAGCAGATGC
TGCACCTGATGGCGGTGGCTCGCTCGGCGCGCGGCGACGACATGGGCCGCTTCCTCCTGTCGAGCCTGGA
CAGCCAGTACCGCAAGCGCTGGAACTGGGCGGCGGACTCGCTGGACCTCCTGGGCACGCGTGCGACCGGG
AAGGATGGCGACTGGATGCAGGCCACCGGTCTGCGCGAGGAGGTCGTCGGCGACTACATCATCTCCAGCG
ACCAGGCCTGGCGCGCGGGCATGCAGACGCAAGCGCAGGTTCCTTGGATGAAGTGGCCCTACCAGTGGCT
GCGGGAGGAGAGCTACCTGGGCCCGTGGCGGGACCACCTCATGCGCCTGCAGCTGGTGCTGGGGGCTCGC
GAGCTGAACCTGGAGCAGTGGCGCACGCTCGCGAGTGAGCGTCAGCGGCTCCAGATAACGCTGGCGCAGA
GCATCTCCTATACGTCCGCGCACAAGCTGCTGGCGCTGCTCGACGCGTCCGGCTCGCCGGAGAGCCAGGC
GACGCTCAAGGGCGTGGAGAACACGCTCGACTCGCTCGACTGGCACCGGGACCACCAGGCCATGCTGGCG
GCGGTGCTGCGCATGGAGGAGGAGATCGACGCGGGCCTGAAGGCCGCCGAGGAGATGTCCACGGCGGAGC
TCCTGACGCGCACCGGCGGCCTCTTCGTGCCCGCGAACGCGGACGCGCGCATCGAGGTGCGCGTGCTCCA
GCAGTCCTTCGAGTTCCGCCCCAAGGAGCTGTCGCGCGTGCTGTTGGACAAGCTCTTGCGGCAGATTGAG
CAGGGGCAGAATCCGTTCAGCCGGCGCCTGCTGGGCCTGCCGTCCGGCGTGGTGGCGTCCGCCCAGGAGA
ACGGGCTGGGCATCTCCATCGGCGATACGCTGGACGTGGGGCATGTGGACGCGATGCCCTCGAACCATGG
CTCGGAGTGGCTGAACTTCGAGACCGACATCCGGCCCCTGGTGGATGAGTTCACCATCCGCATGACGGAC
TCGAAGCTCTCCCGCGCGGAGGCCGCGCAGCGCCAGGGCTACGTGCTGAAGAAGGTCTCCAACTTCGGGC
AGCGATACCGGCAGGACCTGCTGGTGAAGTACCGCGACTATCGCTTCACGGCGCTGACGACGACGCTGGC
CTCGGAGCTCTCCGCGGTGACGCAGCCGACGTCGGAGCTGGTGGCGATGCTCCGCGACGTGTCGACGGGC
GCGGGCATCGGCCCGATGGAGGGCCCCTACTACGAGCCCCTGCGCCAGGAGCTGTCGGCCTTCCGTCCCG
TCGTCCAGCTCATGACGCCGGACAAGGATGGACAGACGAAGGAGCTGTCGTCGTTCCTGCTGCTGGTGTC
GCAGCTGCACACGGAGGTCTCCGGCTTCAACGCGCCGCCGATGTTGAGCGACCGCACGGTGGTGCCCGCG
GCGATGCGCACCGGGGGCCCGGATGCGCCCGCGGCGGCCGAGGAGAGTGGCCGGCAGCTGGTGGACCTGC
TCTCGCCGCTGGGCCGCGTGGGCCTGTCGATGCTGCTCGACGAGGAGGGCTCGTACCTGCGCAAGGTGGA
TGCGTGGCTGGACAAGCAGGGCATCCTGGGTGAGCTGCGGCGGCCGTTCCGCGAGCCCTTCCTGGTGACT
CGGGAGCTGGGCCGGGCGGAGCTGGAGCGCGTGCTGGAGGAGCAGTGGGAGTGGCGCTTCCGGACGCTGC
TCACGCCGCTCATGCGCCGCTATCCGTTCGCGGTGGAGGCGAGCCAGGAGCTGGACCCGACGGAGCTGGA
CGTCCTCAAGCGCAAGGACGGCGCGTTCTGGCAGTTCGTGAACCAGGTCCTGTCGCCGGTGGTCGAGGAG
CGCGGCACGGAGTGGATGCTGCGTCGGCCGCTGCGGCAGCAGCTGGCGGTTCCGCCGCGCATGCTCGCGA
TGCTGAGCCGGCTGTCGAAGCTGGCGCGGCTGTTGTGGACGGAGGAAGGCAAGCCGAAGCCCTTGATGCT
CCAGGTGCGTCCGCTGCCGCTGCCGCCCTCGGGGGACAGCGGGTTCGTGACCATGTCGTTCCTGAAGTGC
GGCGAGGCGGCGTCCTTCGGCTTCAACCAGACGCCCGCGTGGCAGGACTTCGCGCTGGCGTGGTGGGAGC
CTCGGTCCGCGTCCGTGGGCGTGGAGCTGCGCGTCCCGGGACGCGAGGGCAAGCGCTACCGGTCCACGGA
GCTGTCGCGCTCGTCGTGGAACTGCTTCCGCATCCTGGACGCGGCGACGTTCGACGCGGAGCAGAACGCC
ATCTGGCCGCTGCCGGGCCCGGATGGCTCCGAGCACTCCGAGATTCGACTGCGCTTCGGCATGCGCGGGG
GGCCCTGGACCCTCTTCCAGGAGGTGACGCGATGA
 Primer design