SecReT6
Protein ID: 442321727
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04774
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6119172..6122837 [-]
Producthypothetical protein
NoteTssM
UniProt IDL7UHY7
KEGG IDmsd:MYSTI_04774
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.10E-81, Aligned region: 76..104
ImcF-related_N [PF14331], Evalue: 2.10E-81, Aligned region: 176..439
IcmF-related [PF06761], Evalue: 2.20E-35, Aligned region: 485..804
DUF1215 [PF06744], Evalue: 1.90E-20, Aligned region: 938..1056
IncA [PF04156], Evalue: 0.0099, Aligned region: 2..105
Protein Sequence: 1221 a.a.     [Download]
>gi|442321727|ref|YP_007361748.1| hypothetical protein MYSTI_04774 [Myxococcus stipitatus DSM 14675]
MLALTVLIAVFIVLVWTAVLLLSLPLWGAIVPTVLLVFIIVAAYLFQRHQASKAARDIERELGVQADAQL
QNVRPDQQEEIQAMQAEFSKALQSLKSSKLARARQGKDALSVLPWYMIIGPPGSGKSTALRNSGIQFPYL
SSRGGGVKGVGGTRNCEWWLTNEGVILDTAGRYTTEDDDREEWLSFLDMLKRNRPRKPVNGLVVAVSVGD
LIGIDEEQSVQLAQTIRERVDEVMERLKMIVPVYVMFTKCDLLAGFVDIFGDLPKTERGQIWGFTVRPED
ARDAIGETFAARFDELAEVVEQRCIVRIGAERHPETRERIFRFPQQFEGLRSNLIEFTQALFAENVYADT
PVMRGVYFTSGTQEGSPIDRVMNAMADAFGIRRTTTPDGGRPAVEARSYFLRDMFAEVVFPDQNLAMMSS
AEVLRQKRIQLGYAGGCLAVALLILLFPTMSFVKNRRFIQTTMVMAQALKLQEAGATGAGPMVDAMLPMR
QQIDKLLEWEQEGPPAGMRLGLYRGDELIAPLGAFYGATVRRVLIDPVLTSDLKEMKTWVEAQRQGDETP
TGREYARYFDRLKLHLLLSGPRTAREPELGDGVRSWLVKSLTERWGRKPGFTDSAHRTTQMSNHVDSFVK
LLAQDSTNLAFTRNDKVVRDVRVILDRLPFSTLALEQLIADVGREGYDITISSVLGSTTQHIKGDGRVRG
AFTRKGWETVVSAKLEHPLQGADIWVLDKDTNATNELELERQERILRSAYYEQYILEWKAFLSSLRVQPP
TNTTEALALLEDLTRGEPPPLARLFKAVDYNVSLGAEEIDTSAVEDGVLKKLKGKLGAGATAVEKGVRFA
SEKVAGGEDSEVEYFTEQSVKPSFKGLTDFGAPPKRAKGPDAPPPESIPLDLYQEQLQFLRDAQRAAMES
QDESAAMMARVQTARVSVQSLIKAQEVGWRPRIEALLWPPIEAISELTLKEAGGKASDQWCSEVATAFNQ
KLAGHYPFNRNGQDSAVADVGDFFRPESGTLWGFYSGVLKSHVEQSGSRFKFVTRAGRAGGSLYYGSVLT
FLSRSREISESLFAPRDAEPGVKFTFHIRPSPKLASIRFTVDGQTVDYNNGPEEWHQFEWPGKGGKSVGA
SIRVRNNRGQPETVEQEGEWGLFRLLEEGTARVEGGARVFSVTWALPSSETEVVIDFKPSRSASPFFGVT
AGRNAKLMQPFRMPGVQPPRVIAKGGSGCSG
 
Nucleotide Sequence: 3666 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6122837-6119172 Myxococcus stipitatus DSM 14675, complete genome
ATGCTGGCTCTCACCGTGCTCATCGCGGTCTTCATCGTCCTGGTGTGGACCGCCGTCCTGTTGCTCAGCC
TGCCGCTGTGGGGCGCCATCGTCCCCACCGTGTTGCTGGTGTTCATCATCGTCGCCGCCTACCTGTTCCA
GCGCCACCAGGCGTCCAAGGCGGCGCGCGACATCGAGCGGGAGCTCGGCGTGCAGGCGGACGCCCAGCTC
CAGAATGTCCGGCCGGATCAGCAGGAAGAGATCCAGGCCATGCAGGCCGAGTTCTCCAAGGCGCTCCAGT
CGCTCAAGTCCTCCAAGCTGGCGCGTGCGCGGCAGGGCAAGGACGCGCTGTCGGTGCTGCCCTGGTACAT
GATCATCGGGCCGCCGGGCTCCGGGAAGAGCACCGCGCTGCGCAACTCGGGCATCCAGTTCCCGTACCTG
TCCTCGCGCGGCGGCGGCGTGAAGGGCGTCGGCGGTACGCGCAACTGCGAGTGGTGGCTGACCAACGAGG
GCGTCATCCTCGACACGGCGGGCCGCTACACCACCGAGGATGATGACCGCGAGGAGTGGCTGAGCTTCCT
CGACATGCTCAAGCGCAACCGTCCGCGCAAGCCCGTCAACGGGCTGGTGGTGGCGGTGAGCGTGGGAGAC
CTCATCGGCATCGACGAGGAGCAGTCGGTGCAGCTCGCGCAGACCATCCGCGAGCGCGTGGACGAGGTGA
TGGAGCGATTGAAGATGATCGTTCCGGTCTACGTGATGTTCACCAAGTGCGACCTGCTCGCGGGCTTCGT
GGACATCTTCGGAGACCTGCCGAAGACGGAGCGCGGGCAGATCTGGGGCTTCACGGTGAGGCCGGAGGAT
GCCCGGGACGCCATCGGTGAGACGTTCGCCGCGCGCTTCGACGAGCTGGCCGAGGTGGTGGAGCAGCGCT
GCATCGTGCGCATCGGCGCGGAGCGCCACCCGGAGACGCGCGAGCGCATCTTCCGCTTCCCGCAGCAGTT
CGAGGGGCTGCGCTCGAACCTCATCGAGTTCACGCAGGCGCTCTTCGCGGAGAACGTCTACGCGGACACG
CCGGTGATGCGCGGCGTGTACTTCACGAGCGGCACGCAGGAAGGCAGCCCCATCGACCGCGTGATGAACG
CGATGGCGGACGCCTTCGGCATCCGGCGCACCACCACGCCCGACGGTGGCCGTCCGGCGGTGGAGGCGCG
CAGCTACTTCCTGCGGGACATGTTCGCGGAGGTGGTCTTCCCCGACCAGAACCTCGCGATGATGAGCTCG
GCGGAGGTGTTGCGGCAGAAGCGCATCCAGCTCGGCTATGCGGGAGGCTGCCTCGCGGTCGCGCTGCTCA
TCCTGTTGTTCCCCACGATGTCCTTCGTCAAGAACCGGCGCTTCATCCAGACGACGATGGTGATGGCGCA
GGCGCTCAAGCTGCAGGAGGCGGGAGCGACGGGCGCGGGGCCCATGGTGGACGCGATGCTCCCCATGCGG
CAGCAGATCGACAAGCTGCTGGAGTGGGAGCAGGAGGGGCCGCCCGCGGGGATGCGCCTGGGCCTGTATC
GCGGGGACGAGCTCATCGCGCCGCTGGGCGCGTTCTACGGCGCCACCGTGCGGCGCGTGCTCATCGACCC
GGTGCTGACCTCGGACCTGAAGGAGATGAAGACCTGGGTCGAGGCCCAGCGGCAGGGGGACGAGACGCCG
ACGGGCCGCGAGTACGCGCGCTACTTCGACCGGCTGAAGCTGCACCTGCTGCTCTCGGGGCCGCGCACGG
CCCGTGAGCCGGAGCTGGGGGATGGCGTGCGCTCCTGGCTGGTGAAGAGCCTGACGGAGCGCTGGGGCCG
CAAGCCTGGGTTCACCGACAGCGCCCACCGCACGACGCAGATGTCCAACCACGTCGACTCGTTCGTGAAG
CTGCTGGCGCAGGACTCGACCAACCTGGCCTTCACGCGCAACGACAAGGTGGTCCGCGACGTCCGCGTCA
TCCTGGACCGGCTGCCCTTCTCCACCCTGGCGCTGGAGCAGCTCATCGCCGACGTGGGGCGTGAGGGCTA
CGACATCACCATCTCCTCCGTGCTGGGCAGCACCACCCAGCACATCAAGGGCGATGGACGGGTGAGGGGC
GCCTTCACGCGCAAGGGGTGGGAGACCGTGGTGTCCGCGAAGCTGGAGCACCCGCTCCAAGGCGCCGACA
TCTGGGTGTTGGACAAGGACACCAACGCCACCAATGAGCTGGAGCTGGAGCGGCAGGAGCGCATCCTGCG
GTCGGCGTACTACGAGCAGTACATCCTGGAGTGGAAGGCGTTCCTCTCCAGCCTCAGGGTCCAGCCGCCG
ACCAACACCACGGAAGCGCTGGCCTTGTTGGAGGACCTGACTCGCGGAGAGCCTCCGCCCCTGGCGCGGC
TCTTCAAGGCCGTCGACTACAACGTCAGCCTGGGCGCGGAGGAGATTGATACGTCCGCCGTCGAGGATGG
GGTTCTCAAGAAGCTCAAGGGGAAGCTGGGGGCCGGTGCTACGGCCGTCGAGAAGGGCGTCCGCTTCGCC
AGCGAGAAGGTCGCGGGAGGCGAGGATTCGGAGGTGGAGTACTTCACGGAGCAGAGCGTGAAGCCCAGCT
TCAAGGGGCTGACCGACTTCGGCGCCCCGCCGAAGCGAGCGAAGGGGCCTGACGCGCCGCCGCCCGAGTC
CATCCCGCTGGACCTCTACCAGGAACAGCTCCAGTTCCTTCGCGACGCACAGCGCGCCGCGATGGAGAGC
CAGGATGAATCCGCTGCGATGATGGCCCGCGTCCAGACGGCGCGCGTCAGCGTCCAGTCGCTCATCAAGG
CGCAGGAGGTCGGCTGGCGTCCGCGCATCGAGGCGCTCTTGTGGCCGCCCATCGAGGCCATCTCCGAGCT
GACCCTCAAGGAGGCGGGAGGGAAGGCGAGCGACCAGTGGTGCAGCGAGGTCGCCACCGCGTTCAATCAG
AAGCTCGCGGGGCACTACCCCTTCAATCGCAATGGCCAGGACTCGGCGGTCGCCGACGTGGGTGACTTCT
TCCGGCCGGAGTCGGGAACCCTCTGGGGCTTCTACAGCGGCGTCCTGAAGAGCCATGTCGAGCAGTCGGG
GAGTCGCTTCAAGTTCGTCACCCGAGCCGGCCGCGCGGGCGGCAGCCTGTACTACGGCTCCGTGCTGACG
TTCCTCTCGCGCTCGCGGGAGATCTCCGAGTCCCTCTTCGCGCCTCGGGATGCTGAGCCCGGCGTGAAGT
TCACCTTCCACATCCGGCCTTCGCCGAAGCTCGCGTCCATCCGCTTCACCGTGGATGGGCAGACGGTCGA
CTACAACAACGGTCCGGAGGAGTGGCACCAGTTCGAGTGGCCCGGGAAGGGTGGCAAGTCGGTGGGCGCG
TCCATCCGGGTGCGCAACAACCGGGGCCAGCCCGAGACCGTCGAACAGGAAGGCGAGTGGGGGCTGTTCC
GCTTGCTGGAAGAGGGCACGGCCCGGGTAGAGGGTGGAGCGCGGGTGTTCTCGGTGACGTGGGCGCTTCC
GTCCTCGGAGACGGAGGTGGTCATCGACTTCAAGCCGTCGCGCAGCGCCTCGCCGTTCTTCGGTGTCACC
GCGGGCCGCAACGCCAAGCTCATGCAGCCGTTCCGCATGCCGGGCGTTCAGCCTCCACGCGTCATCGCCA
AGGGAGGCTCGGGATGCTCGGGGTAA
 Primer design