SecReT6
Protein ID: 444350946
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7508
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]792030..795413 [+]
Productprobable membrane protein YPO1482
NoteTssM
UniProt IDL8BCH4
KEGG IDear:ST548_p7508
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-71, Aligned region: 412..727
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 850..970
Protein Sequence: 1127 a.a.     [Download]
>gi|444350946|ref|YP_007387090.1| probable membrane protein YPO1482 [Enterobacter aerogenes EA1509E]
MFKEKNAAVMTVAATATLCLAVWTIVVLLSGLGWWNWHANRTLQWTAIREIVTVCGLIWAYGLCLWILGF
IAFHLFIRQKADGQQRQTRTFISQQTKPAQPFASLKHFLRRRYGRLWRNKVRLLWVAGEAAQIAAIAPGL
AQQQWLEGRGTVLIHGGSLLAEVDNERLSALRRLRGRRPLDGIVLALDNAQATAATLDGYLRTLEQVAQV
LRYQPPVYLWQLHDSDWLQDTRITQTLGALFPPRAVPQDVERQLRAILPAMLAQGTQQLCADSSHDYLLR
VAKWLKEGGISGWKTLLTPWLTGYLQQIPLRGLLFSPSLKAEEAVDNGLYPHRWPAPAVWQGIIADCGRA
RGVPVGVAWRRSLGVGLLALFGLWAAGSLLSFIVNRQQIVSATQRVQLLRQPVVNDQQLIDLQVLRNDIG
RLQNQLANGAPWYQRFGLNHNAPLSAALLPWYGRANQRLIRDAAAEALTRQLTVLVNLPPRSPQRAQLAK
AGYDQLKAYLMMARPDKADAAFYRQAMTAAQQTRQGVAPALWQSIAPDLWGFYMDNLPSQPTWRITPDAA
LVTQARQVLLAQIGRRNAESTLYENMLLQVRRNYADMTLEDMTPQTNASRLFTTEEVVPGMFTRQAWEGG
VREAIDKAVATRRDEIDWVLSDSRQTVSGDVSPEALKQRLTDRYFTDFAGAWLGFLNSIRLNPARNIADV
TDQLTLAGDVRQSPLIALMNTLAWQGQTGQQREGVADSLVKSAKSLLDKDKQPFIDQQAGGVRGPLESTF
GPLLALMGKNPSQSVVAADNTLSLQTWLTRLTRVRLRLQQVANAPDPQAMMQQLAQTVFQGKSVDLTDTQ
EYGSLVAASLGEEWSGFGQTMFVQPLTQAWETVLQPSAASLNEAWQRSVVANWHSAFDGRYPFAAGKNDV
SLPMLAAFIRRDSGRIDQFLARQLGGVLNREGSRWVADSAHSQGLTFNPAFLKAINQLSSLSDILFTDGS
QGMGFELQGVATPGIVETQLTLDGQNLHYFNQLAEWKSFRWPGTINKPGAMLSWSSVAAGARLLANDSGP
WGTLRMLERMKRQQIGDGLFRLTVNTPDNRQLQWLLRTELGDGPLALLKLRNFTLPTQIFIVEASRAEPF
ADGDVEE
 
Nucleotide Sequence: 3384 bp     [Download]
>gi|444350194|ref|NC_020181.1|:792030-795413 Enterobacter aerogenes EA1509E, complete genome
ATGTTCAAGGAAAAAAATGCCGCGGTAATGACCGTAGCGGCTACCGCGACCCTGTGTCTTGCCGTCTGGA
CAATTGTGGTCCTGCTGAGTGGTCTGGGATGGTGGAACTGGCACGCCAACCGCACGCTGCAGTGGACGGC
GATCCGCGAGATAGTGACCGTCTGTGGCCTGATCTGGGCGTATGGTCTCTGTCTCTGGATACTGGGCTTT
ATTGCTTTCCACCTGTTTATCAGGCAAAAAGCCGATGGGCAACAGCGTCAGACGCGGACTTTTATTAGCC
AGCAGACAAAACCGGCGCAGCCGTTTGCGTCCTTAAAGCACTTTCTCCGTCGCCGCTACGGCCGATTGTG
GCGCAATAAGGTCCGCCTGCTGTGGGTCGCTGGCGAGGCGGCGCAGATTGCCGCCATCGCTCCAGGCCTT
GCGCAACAGCAATGGCTGGAGGGCCGCGGTACGGTGCTAATTCACGGCGGTAGCCTGTTGGCTGAGGTGG
ATAACGAGCGGCTCAGTGCCCTGCGTCGGCTGCGCGGCCGCCGGCCGCTGGATGGTATCGTGCTGGCGCT
GGACAATGCTCAGGCCACCGCCGCGACCCTGGACGGGTATTTGCGAACGCTGGAGCAGGTTGCGCAGGTT
CTGCGCTACCAGCCGCCGGTCTATCTGTGGCAACTCCACGACAGCGACTGGCTGCAGGATACGCGCATTA
CCCAGACGCTGGGGGCGTTGTTCCCGCCGCGGGCCGTCCCGCAGGATGTTGAACGGCAGCTTCGCGCCAT
TCTGCCCGCCATGCTGGCGCAGGGGACCCAGCAGTTGTGCGCTGATTCGTCCCACGATTACCTGCTGCGT
GTCGCTAAATGGCTGAAGGAGGGCGGTATCAGCGGCTGGAAGACGCTACTGACGCCGTGGCTTACTGGGT
ATCTGCAACAGATCCCGCTCCGCGGTCTGCTGTTCAGCCCCTCGTTAAAGGCGGAAGAAGCGGTGGACAA
TGGGCTCTATCCCCACCGTTGGCCGGCCCCGGCCGTCTGGCAGGGGATCATCGCAGACTGCGGCCGCGCG
CGCGGCGTGCCGGTGGGGGTGGCGTGGCGCCGCTCCCTCGGCGTCGGCCTGCTGGCGCTGTTTGGCTTGT
GGGCGGCGGGAAGCCTGCTCTCTTTTATCGTCAACCGCCAGCAAATTGTCAGCGCCACCCAGCGGGTACA
GCTGCTGCGGCAGCCCGTCGTTAACGACCAGCAGCTGATCGATTTGCAGGTGCTGCGCAACGATATCGGC
CGTCTACAGAATCAGCTCGCCAACGGCGCGCCCTGGTATCAGCGCTTTGGTCTTAATCATAATGCGCCGC
TTTCTGCCGCGCTGCTGCCGTGGTATGGGCGGGCTAACCAGCGTCTGATCCGCGACGCCGCGGCAGAAGC
GCTCACCCGGCAACTGACGGTGTTGGTCAACCTACCGCCGCGCAGCCCGCAGCGGGCGCAGCTGGCGAAA
GCGGGTTATGACCAGTTAAAGGCCTATCTGATGATGGCGCGTCCGGACAAAGCCGATGCGGCGTTTTACC
GCCAGGCAATGACCGCCGCGCAGCAGACGCGTCAGGGAGTCGCCCCGGCGCTATGGCAGAGCATCGCCCC
CGATTTATGGGGCTTCTATATGGACAACTTGCCATCGCAGCCGACGTGGAGAATCACCCCGGACGCCGCG
CTGGTGACGCAAGCGCGTCAGGTGCTGCTGGCGCAAATCGGGCGGCGCAACGCCGAAAGCACGCTTTACG
AGAACATGCTGCTGCAGGTGCGCCGTAACTATGCCGACATGACGCTGGAAGACATGACGCCGCAGACCAA
TGCGAGCCGGTTGTTTACCACGGAAGAGGTGGTGCCGGGGATGTTTACCCGTCAGGCGTGGGAGGGCGGC
GTGCGCGAGGCGATCGATAAGGCGGTGGCGACCAGGCGCGATGAGATCGACTGGGTGCTGAGCGATAGCC
GCCAGACCGTCAGCGGCGACGTCTCCCCGGAGGCGTTGAAACAGCGGCTGACCGATCGTTATTTCACCGA
TTTCGCCGGGGCGTGGTTGGGTTTTCTCAATAGCATCCGCTTGAATCCGGCGCGCAATATTGCCGATGTG
ACCGATCAGCTGACGTTGGCGGGCGACGTTCGTCAGTCGCCGCTGATTGCGTTGATGAATACCCTTGCCT
GGCAGGGGCAGACCGGGCAGCAGCGTGAGGGCGTGGCGGATTCGCTGGTGAAATCGGCAAAAAGTCTACT
CGATAAGGATAAGCAGCCGTTTATCGACCAGCAGGCCGGCGGCGTGCGCGGCCCGCTGGAGAGCACCTTT
GGGCCGCTGCTGGCGCTGATGGGCAAAAATCCCTCTCAGAGCGTGGTCGCCGCAGACAACACCCTCAGTT
TACAGACCTGGCTGACGCGCCTGACCCGCGTACGCCTGCGGCTCCAGCAGGTGGCAAACGCCCCCGACCC
GCAGGCGATGATGCAGCAGCTGGCGCAGACCGTGTTCCAGGGTAAAAGCGTCGACCTGACCGACACCCAG
GAGTACGGCAGCCTGGTGGCGGCCAGCCTCGGCGAAGAGTGGAGCGGTTTCGGCCAGACCATGTTCGTCC
AGCCGCTGACGCAGGCCTGGGAAACGGTGCTGCAGCCATCGGCTGCCAGCCTGAACGAGGCGTGGCAGCG
TTCTGTGGTCGCTAACTGGCATTCGGCTTTCGACGGCCGCTATCCGTTTGCCGCGGGCAAAAACGATGTC
TCGCTACCGATGCTGGCGGCATTCATCCGTCGCGATAGCGGGCGAATCGACCAGTTTCTTGCCCGACAGT
TGGGCGGCGTGCTCAACCGGGAGGGTAGCCGCTGGGTGGCCGATAGCGCGCACAGTCAGGGGCTGACTTT
CAATCCGGCCTTCCTGAAGGCGATTAATCAACTGAGTTCCTTGTCCGACATCCTGTTTACCGACGGCAGT
CAGGGAATGGGGTTTGAACTACAGGGGGTGGCGACGCCGGGGATCGTTGAAACGCAACTCACCCTCGACG
GCCAGAATCTGCACTACTTTAACCAGCTTGCCGAATGGAAAAGTTTCCGCTGGCCGGGGACTATCAACAA
ACCCGGCGCGATGCTGAGCTGGAGCTCAGTGGCGGCGGGCGCCCGGCTATTGGCGAACGACAGCGGCCCG
TGGGGCACGCTGCGTATGCTGGAGAGAATGAAGCGCCAGCAGATCGGCGATGGGCTGTTTCGTCTGACGG
TCAATACGCCGGATAACCGGCAACTGCAGTGGCTGCTGCGTACCGAACTCGGCGATGGCCCGCTGGCGTT
GCTGAAACTGCGAAACTTCACGTTGCCGACACAGATTTTCATCGTGGAGGCCTCCCGTGCGGAACCGTTT
GCTGACGGTGACGTAGAGGAATAA
 Primer design