SecReT6
Protein ID: 444351397
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7057
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1256859..1260470 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDL8BFT9
KEGG IDear:ST548_p7057
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.70E-99, Aligned region: 204..480
IcmF-related [PF06761], Evalue: 6.30E-88, Aligned region: 528..831
DUF1215 [PF06744], Evalue: 8.60E-30, Aligned region: 944..1069
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 139..261
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 806..886
Protein Sequence: 1203 a.a.     [Download]
>gi|444351397|ref|YP_007387541.1| IcmF-related protein [Enterobacter aerogenes EA1509E]
MLTLLLSILTNRLLWGFLGATAVAAVIWMIGPLLSIVDTRPLESEQNRVISIALVYLIWAQSHILPRLYN
AWLNRKLMDNLKEETPKGNDPQQRLNSEDQILADRFDEAAQMLKKAHFSKTGNGQWTQRFSTHYLYQLPW
YVIIGASGSGKTTALANSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQAQDA
SEWLKFMGLLRKYRRRQPINGVIVTVSISDLLTQSTEASRQQAVNLRQRLSELHEQLGIRFPVYVLVTKA
DLLKGFRAWFAGYDKAQRDQIWGFTFPWEQASLADFDLMGRFTQEFALLQQRLEAGLPDTMLQEHDAKTR
AEAWLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYFASGTQEGLPFDRVMGELNRALSLPQGNEN
DNWDSVSKEAPIPGAKGQSYFIKNLLQNVIFQEAGIAGQNRWWELRNRAAIWSGYAALAALLIISCVLWL
TSYGKNKAYLQEVSAKVPQVEQQSKALQNPEQRDLFAMLPLLNGLLELPKSADFDVNDPPVSRRMGLYRG
NDVSDASQTLYQKALQQMLLPDVAMRITTWLRNDNGSDAEYSYEALKAYQMLYQPKQYDGKFLLSWVMLN
LQRNLPQNVTQAQLRQLEGHLVQLLEPQIQSSPYAKDDALIARERALINQQPLSSRVYGRLKRLLEHDDN
LKAVSLATLGGPQSELVFSRKSGTPIAEGVPGLYTPDGYWQVFNKQIDNVTSALHEDDIWVLGAASASED
KQQTDNAVRQLYMRDFIANWDRFLADIQLNNSADLSSRINTARLLSASNSPLRRLVISLSQVLNLARAEP
DTVKSESSAEQGNRATRTLEALFRHDEGGATQGAALSQTPEQLVTEHYAPLIELAQPLEKGGKTIVFDDF
LKQIDELYRYLTAVQDAANSGMQPPGGDAISRLQASAGRLPGGLQTMFSKMAVGASSDTQRRDLDNVRKR
INVEVGGFCRQAIAGRYPLVRSARSEVTPDDLARMFAPGTGMMDTFFRDNLTNKVDTTQSSWRFMPGIDG
KTLPGSEGLLRPFQQAQSIRDAFFANGATTPSFKVTVRTISMDNRILNLTLDVDGQQLRYSHGPQAVQMM
SWPGPGGTNQVRMQLGLADGTTSTLVTSGSWALNRFFDKARTAPGSSSLSRQATFNVDGYQVTLEFAPNS
IRNPFQLPRFSCP
 
Nucleotide Sequence: 3612 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1256859-1260470 Enterobacter aerogenes EA1509E, complete genome
ATGCTGACACTTCTGCTTTCCATACTGACCAACCGGCTGCTGTGGGGTTTTCTCGGCGCCACGGCGGTGG
CGGCCGTCATCTGGATGATTGGCCCGCTATTGTCGATTGTCGATACCCGGCCGCTGGAATCGGAACAAAA
CCGCGTTATATCTATTGCGCTGGTCTACCTCATCTGGGCGCAAAGCCACATTCTGCCGCGCCTGTACAAC
GCCTGGCTCAACCGCAAGCTGATGGATAACCTGAAGGAAGAAACACCGAAGGGCAACGATCCGCAGCAGC
GCCTCAATAGCGAAGACCAGATCCTCGCCGATCGCTTTGATGAAGCCGCGCAAATGTTGAAAAAAGCGCA
CTTCAGTAAAACCGGTAATGGTCAGTGGACCCAGCGCTTTAGCACCCACTATCTGTATCAGCTGCCGTGG
TATGTGATTATTGGCGCATCTGGCTCCGGTAAAACCACAGCCTTAGCCAACTCCGGGCTGCAGTTTCCGC
TAGCCGACCGCTTCGGTAAAACGGCGTTACGCGGTATCGGCGGCACGCGCAACTGTGACTGGTGGTTTAC
CAACGAAGCCGTGCTGCTGGACACCGCCGGGCGCTATACCACCCAGGAGAGCGAGCAGGCGCAGGACGCC
AGCGAGTGGCTGAAGTTTATGGGGTTATTGCGGAAATACCGCCGCCGCCAGCCGATTAACGGCGTTATCG
TCACGGTAAGTATCTCCGATCTGTTAACGCAATCGACGGAGGCCTCGCGGCAGCAGGCGGTTAATCTGCG
CCAGCGTCTCTCTGAACTACATGAACAATTGGGTATTCGTTTCCCGGTATACGTACTGGTGACGAAGGCC
GATCTGCTTAAAGGCTTCCGCGCCTGGTTTGCCGGTTACGACAAGGCGCAGCGCGATCAAATCTGGGGCT
TCACTTTCCCGTGGGAGCAGGCAAGCCTTGCCGACTTCGATCTGATGGGCCGCTTTACCCAGGAGTTTGC
GTTACTGCAACAACGGCTTGAAGCCGGGCTGCCGGATACGATGCTGCAAGAGCATGATGCCAAAACCCGC
GCCGAAGCCTGGCTGTTCCCGCAAGAGTTTGCGGCGTTGCGACCGCTGTTAGCGGACTATCTTAGTACCG
TTTTTGCCCGCTCTAACTTTGAAACCGAGTTTTCACCGCGCGGCATTTATTTCGCCAGCGGCACCCAGGA
AGGGTTACCGTTCGACCGCGTGATGGGCGAACTCAATCGCGCGCTGTCTTTGCCGCAGGGAAATGAAAAC
GACAACTGGGACTCGGTCAGTAAAGAAGCGCCGATCCCCGGCGCCAAGGGCCAGAGTTATTTCATTAAAA
ACCTGCTGCAAAACGTGATTTTCCAGGAAGCCGGCATCGCCGGGCAGAACCGCTGGTGGGAACTGCGTAA
CCGCGCGGCGATCTGGTCAGGCTATGCGGCGCTCGCGGCGCTGTTAATCATTTCATGCGTACTGTGGCTG
ACCAGCTACGGCAAAAACAAGGCCTACCTGCAAGAAGTCTCGGCGAAGGTGCCGCAGGTTGAGCAGCAGA
GCAAAGCGCTGCAAAACCCCGAGCAGCGCGATCTGTTCGCCATGCTGCCGCTACTCAACGGCCTGCTGGA
ATTGCCGAAGAGCGCCGATTTTGACGTCAACGACCCGCCGGTTAGCCGCCGGATGGGGCTCTACCGCGGG
AATGATGTCAGCGACGCCTCGCAGACGCTGTATCAAAAAGCGCTGCAGCAAATGCTGCTACCGGATGTCG
CCATGCGTATCACTACCTGGTTGCGCAACGACAACGGCAGTGACGCCGAATATAGCTACGAGGCGTTGAA
AGCCTATCAAATGCTCTATCAGCCCAAGCAGTATGACGGCAAGTTTTTACTCTCCTGGGTGATGCTTAAC
CTGCAGCGTAACCTGCCGCAAAACGTGACGCAGGCGCAGCTACGACAGCTGGAAGGGCATCTGGTCCAGC
TACTGGAACCGCAAATCCAGTCCTCGCCGTATGCCAAAGACGATGCGCTGATCGCCCGCGAACGGGCGTT
GATTAACCAGCAACCGCTCTCCTCAAGAGTGTATGGTCGGCTGAAACGTCTGCTTGAGCATGACGACAAT
CTGAAAGCGGTCTCGCTGGCGACGCTCGGCGGGCCGCAGAGCGAACTGGTGTTCTCGCGTAAAAGCGGTA
CACCGATCGCAGAAGGCGTGCCAGGGCTGTACACGCCAGATGGCTACTGGCAGGTGTTCAATAAACAGAT
CGATAACGTGACCAGCGCGCTGCATGAAGATGATATTTGGGTGCTGGGCGCCGCCAGCGCGTCGGAAGAT
AAGCAGCAAACCGATAACGCCGTCCGCCAGCTCTATATGCGTGATTTTATCGCCAACTGGGATCGCTTCC
TCGCCGATATTCAGCTCAACAATAGCGCCGATCTGTCATCGCGGATCAACACCGCGCGCCTGCTTTCCGC
CAGTAACTCGCCGCTGCGCCGGCTGGTTATCAGCCTGAGCCAGGTGCTGAACCTGGCGCGCGCTGAGCCG
GATACGGTTAAAAGCGAAAGTTCAGCCGAGCAGGGCAACCGTGCGACCCGAACGCTGGAAGCGCTTTTTC
GCCATGATGAGGGCGGCGCAACCCAGGGCGCGGCGCTTAGCCAGACGCCGGAACAGCTGGTAACCGAACA
CTACGCGCCGCTGATCGAGCTGGCGCAGCCGTTGGAAAAGGGCGGCAAAACGATTGTGTTTGACGACTTC
CTCAAACAGATCGACGAACTTTATCGCTACTTGACCGCGGTACAGGATGCCGCCAACAGCGGTATGCAAC
CGCCGGGCGGCGATGCGATTAGCCGTCTGCAGGCCAGCGCCGGGCGCTTACCGGGCGGCCTGCAAACCAT
GTTCAGCAAAATGGCGGTCGGCGCCAGCAGTGATACCCAGCGCCGCGATCTCGATAACGTACGTAAACGG
ATTAACGTGGAAGTCGGCGGATTCTGCCGCCAGGCTATCGCCGGGCGCTATCCGCTGGTTCGCAGCGCCA
GAAGCGAAGTCACGCCGGACGATCTGGCGCGTATGTTCGCGCCGGGTACCGGCATGATGGATACCTTCTT
CCGTGACAACCTGACCAATAAAGTCGATACCACGCAATCAAGCTGGCGTTTTATGCCCGGCATCGATGGC
AAAACGTTGCCGGGTAGTGAAGGGTTATTAAGGCCTTTCCAGCAGGCGCAATCGATCCGCGACGCGTTCT
TTGCCAATGGCGCGACCACGCCGTCATTTAAAGTGACGGTGCGCACCATCAGCATGGACAACCGGATCCT
CAACCTGACGCTGGATGTTGATGGCCAGCAGTTGCGCTACAGCCACGGTCCGCAGGCGGTGCAAATGATG
AGCTGGCCAGGGCCGGGCGGCACCAATCAGGTGCGTATGCAACTCGGTCTGGCCGATGGTACCACCTCGA
CGCTGGTGACCAGCGGCTCATGGGCGCTGAACCGCTTTTTTGATAAAGCGCGCACCGCGCCCGGCAGCAG
CAGTTTGAGCCGTCAGGCAACGTTTAACGTCGATGGTTATCAGGTCACGCTGGAGTTTGCGCCGAACAGT
ATTCGCAATCCGTTCCAGCTTCCCCGTTTCTCATGTCCATAA
 Primer design