SecReT6
Protein ID: 447916362
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06810
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1479598..1481118 [+]
Productsigma-54 dependent transcriptional regulator, Fis family protein
NoteSfa2
UniProt IDM4JXY3
KEGG IDppz:H045_06810
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 4.80E-68, Aligned region: 85..108
Sigma54_activat [PF00158], Evalue: 4.80E-68, Aligned region: 196..363
Sigma54_activ_2 [PF14532], Evalue: 1.60E-22, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 5.00E-11, Aligned region: 353..360
HTH_8 [PF02954], Evalue: 5.00E-11, Aligned region: 455..495
AAA_5 [PF07728], Evalue: 2.90E-06, Aligned region: 96..110
AAA_5 [PF07728], Evalue: 2.90E-06, Aligned region: 220..338
HTH_30 [PF13556], Evalue: 2.50E-05, Aligned region: 449..464
HTH_30 [PF13556], Evalue: 2.50E-05, Aligned region: 466..495
GAF_3 [PF13492], Evalue: 5.40E-05, Aligned region: 33..162
GAF_3 [PF13492], Evalue: 5.40E-05, Aligned region: 203..244
Protein Sequence: 506 a.a.     [Download]
>gi|447916362|ref|YP_007396930.1| sigma-54 dependent transcriptional regulator, Fis family protein [Pseudomonas poae RE*1-1-14]
MTDEMFTRLPQPLVYAETLMGWFCRLGRGADEKTLANLCVAGVAQLSQCELCQLYRLDQATGRLALIAQH
LHGGWMTSDPALGHGAQDEQLLQYVLAQGQTITLDDLSRCVYDCGFLPEATTSWRSLCGIPLRGPGDTVS
GVLLCASQRPVALQGYVASLAQLGSFALGQLAKASRIAPEVSVLKSGASLAGAFGLIGISTAMEATCRLI
SKVLRTPYTVLLRGETGTGKEVAARAIHAAGQRSHKAFVVQNCAAFPEGLLESELFGYRKGAFTGALRDY
AGLFDAADGGTLLLDEIGDMPLSLQAKLLRVLQEGEIRPLGAVASHKVDVRIIAATHRDLAAMVAEGSFR
EDLYYRLAQFPIELPALRDRDGDMLLLARHFAEKACVALGREAVGWSSDALDQLTNHDFPGNVRELKCLV
ERAVLMCDEDVILPVHLALAPSPVTVVDTTLRKRLERVERTVLIDCLHRNRGNRTRTARELGVARRTLLY
RLARLNIPCGEAKGEC
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1479598-1481118 Pseudomonas poae RE*1-1-14, complete genome
ATGACCGATGAGATGTTTACTCGATTGCCACAGCCCCTGGTCTACGCCGAAACCTTGATGGGCTGGTTCT
GCCGGCTCGGCCGTGGGGCTGATGAAAAGACCTTGGCAAACCTTTGCGTGGCTGGCGTTGCACAACTGAG
CCAGTGCGAACTCTGCCAGTTGTACCGGCTTGATCAGGCTACCGGCAGGCTCGCGCTGATTGCCCAGCAT
TTGCACGGAGGCTGGATGACGAGCGACCCGGCTTTGGGCCACGGAGCGCAGGATGAGCAACTGTTGCAAT
ACGTCCTGGCCCAGGGGCAAACCATCACTTTGGATGACCTGAGCCGGTGTGTGTACGACTGCGGTTTTTT
ACCCGAGGCGACCACATCCTGGCGCTCCCTTTGCGGTATCCCATTGCGTGGCCCCGGCGACACCGTCAGC
GGCGTCCTGCTGTGTGCCAGTCAGCGTCCGGTCGCGTTGCAGGGCTATGTAGCGTCATTGGCGCAATTGG
GCAGTTTTGCCTTGGGGCAACTGGCCAAGGCATCGCGCATCGCGCCTGAGGTGAGCGTGCTGAAGTCTGG
CGCTTCGCTGGCGGGAGCGTTCGGCCTGATTGGCATCAGCACGGCGATGGAGGCGACTTGTCGCCTGATC
AGCAAGGTTTTGCGCACGCCCTATACGGTGCTGTTGCGTGGCGAAACCGGCACCGGCAAGGAAGTCGCGG
CGCGCGCCATCCACGCCGCAGGCCAAAGAAGTCACAAAGCCTTTGTGGTGCAGAACTGTGCGGCGTTTCC
AGAGGGGCTGCTGGAGAGCGAACTGTTCGGTTATCGCAAAGGTGCGTTCACCGGTGCGCTGCGTGACTAC
GCGGGGTTATTCGACGCCGCCGATGGCGGCACGTTGCTGTTGGATGAAATCGGCGATATGCCGCTGTCGT
TGCAGGCCAAGTTGCTGCGTGTGTTGCAGGAGGGCGAGATTCGACCGCTGGGGGCCGTTGCCTCGCACAA
GGTCGACGTGCGAATCATTGCCGCTACGCACCGCGATCTGGCGGCAATGGTCGCCGAAGGCAGTTTCCGT
GAGGATCTGTATTACCGGTTGGCACAATTTCCGATCGAGCTGCCGGCGCTGCGTGACCGAGACGGCGACA
TGCTGTTGCTCGCCCGACATTTCGCGGAAAAGGCCTGCGTGGCACTTGGAAGGGAGGCCGTCGGCTGGTC
CAGTGACGCCCTGGACCAACTGACGAATCATGACTTCCCCGGCAATGTGCGCGAACTCAAATGCTTGGTG
GAGCGTGCCGTGCTGATGTGTGACGAAGACGTGATCCTGCCGGTTCACCTCGCGTTGGCCCCCAGCCCGG
TCACTGTCGTGGACACCACGTTGCGCAAGCGTCTGGAGCGTGTTGAGCGCACGGTGCTGATCGATTGCCT
GCACAGGAATCGCGGCAACCGCACCCGCACCGCGCGTGAGTTGGGGGTGGCGCGGCGCACGCTGCTCTAC
CGCCTCGCTCGTTTGAATATTCCTTGCGGCGAGGCCAAGGGTGAATGCTGA
 Primer design