SecReT6
Protein ID: 447916368
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06840
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1485243..1488575 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDM4K482
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.80E-63, Aligned region: 450..735
IcmF-related [PF06761], Evalue: 1.80E-63, Aligned region: 772..838
ImcF-related_N [PF14331], Evalue: 1.30E-53, Aligned region: 77..102
ImcF-related_N [PF14331], Evalue: 1.30E-53, Aligned region: 179..365
ImcF-related_N [PF14331], Evalue: 1.30E-53, Aligned region: 367..409
ImcF-related_N [PF14331], Evalue: 1.30E-53, Aligned region: 759..794
DUF1215 [PF06744], Evalue: 7.70E-36, Aligned region: 846..970
DUF4131 [PF13567], Evalue: 0.0041, Aligned region: 5..85
DUF4131 [PF13567], Evalue: 0.0041, Aligned region: 393..430
T2SF [PF00482], Evalue: 0.0069, Aligned region: 709..759
T2SF [PF00482], Evalue: 0.0069, Aligned region: 776..833
Protein Sequence: 1110 a.a.     [Download]
>gi|447916368|ref|YP_007396936.1| type VI secretion protein IcmF [Pseudomonas poae RE*1-1-14]
MLAQIWVWSLLLALSGALLIWFVGPLLAVDDYRFWASSTARLLTISVLFLLWGLAMVVAGARRAARLRTP
EHQADQTQYERIENEQKQVRGRFKEALHTLKTSSRYGERSQRWRDDLPWYLLIGAPQSGKTRLLAASGLQ
FPLDRLEPTSTGQTPYCDWYFADNAVLVDTAGRYLTQADRTVDAAGWTTLLRLLRTRRHARPLNGVVVTL
SVEALLGLNDHDLDHHARHVHTRLQDIQRTLRVDLPVYLVLTQADRLTGFAEYFDSTQGDAAAAVLGERL
VENAAGVEIAQVRKAFEALLQRLSGELIPRLHQQRNLQHRGPMLDFAQHAAQLGERLCAFIELGFSAHRY
QRINGLRGFYLTSAAEPRAGFIQGLFNRVIFAEAGLAVLQGQEQRRIRRRQWAGALAASLVIGAAGGLWA
NSYTLNQQRLTQLQALTVEPPVTDGTLEALPLLDARLAATGVFPPAQEVGWVERAGLYQGAASRPTLIDA
YAQSLQRQLLPRVAALLEEQVRNTLGDRERLLDNLRAYLMLALPQRRDNPWLAQHMAALWSARHAADGSA
QKRLNLHLASLLGQDFVAPLDDDLVAQARQALRGESLTDVVYRTLREQARNLEPLRLAEGSVFAAIDQPI
PGFYSKKYWQYFEAQGARLVNAIAQDNWVLGEASDLSAMDLRRLMLELEQRYFSEYADVWSEALGRIRLQ
EIDSLKSAAEQFASLTSAQSPLVQMLQQVRENTRLSPASERLGEVAAQVGALGAKVEAAGAMLTSPLQGL
TQADTARRALQRRFEPLHQLLDEQHNPGTAVSHVLQLSDQLQLQLGTLTRESSSEQAVFNRVKRRMDGQQ
DLLGDLRESAARLPLPLSTWFGAIADDTWQRLLEEAYVHVNQRYQSEVYSVYAKAIRQRYPFNASAGSDV
ALSDFQEFFGPQGVLARFQETYLRPFISADGSRHRLRGIDGRSLPVSRSLLDQLSKVQLIRRSFFSEQGE
LSVRFSLAPYSLDQAVNRAILRLGTQQLEYRHGPIVPMVFQWPVESDNGRSSLVLERGAERPLGIEKNAG
AWSVFRLFDLMQSEPASGRDAQLLKSDLAGLRANYLLTSQRTPSPFQMADWRTFRLPEQL
 
Nucleotide Sequence: 3333 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1485243-1488575 Pseudomonas poae RE*1-1-14, complete genome
GTGCTGGCTCAAATATGGGTGTGGAGCCTGCTGCTGGCGCTTTCAGGCGCACTGTTGATCTGGTTCGTGG
GGCCTTTGCTGGCGGTGGATGATTACCGGTTCTGGGCGTCGTCGACCGCTCGCCTGTTGACCATCAGCGT
GTTGTTTCTGCTTTGGGGGCTGGCCATGGTGGTGGCCGGCGCGCGGCGTGCAGCGCGCCTTCGAACGCCT
GAGCACCAGGCCGACCAGACGCAATACGAGCGCATTGAAAACGAGCAGAAACAGGTGCGAGGTCGCTTCA
AGGAAGCATTGCACACCCTGAAGACCTCCAGCCGATATGGCGAGCGCAGCCAGCGCTGGCGTGACGATTT
GCCCTGGTACCTGCTGATCGGCGCGCCGCAAAGTGGCAAGACGCGTCTGCTGGCCGCCAGTGGCCTGCAA
TTTCCGCTCGACCGGCTCGAGCCGACGTCGACCGGGCAGACGCCTTATTGCGATTGGTATTTTGCCGACA
ACGCGGTACTGGTCGACACCGCCGGCCGCTACCTGACCCAGGCCGACCGGACGGTGGACGCGGCGGGCTG
GACGACGCTGTTGCGACTGCTGAGGACACGCCGGCATGCACGCCCGCTCAATGGCGTCGTGGTGACCCTG
TCGGTGGAAGCGCTGCTCGGCCTGAATGATCACGATCTGGACCATCACGCGCGGCATGTGCATACGCGGC
TGCAGGACATCCAGCGAACCCTGCGTGTGGACTTGCCTGTGTATCTGGTCCTGACCCAGGCCGACCGACT
GACGGGTTTTGCCGAATATTTCGATTCAACTCAAGGTGATGCTGCCGCAGCGGTACTGGGGGAGCGCCTG
GTTGAAAACGCGGCGGGGGTCGAGATAGCTCAGGTGCGCAAAGCGTTCGAAGCCTTGTTGCAGCGCTTGA
GTGGTGAGCTGATCCCGCGTCTGCATCAGCAGCGTAACCTGCAGCATCGCGGGCCGATGCTGGATTTTGC
CCAGCACGCTGCGCAACTGGGCGAGCGCCTGTGTGCGTTTATCGAATTGGGGTTTTCCGCGCATCGCTAC
CAGCGCATCAATGGGTTGCGCGGCTTCTACCTGACCAGCGCTGCCGAGCCGCGTGCCGGTTTTATTCAGG
GCCTGTTCAACCGGGTGATTTTTGCCGAGGCCGGTCTGGCCGTTCTCCAGGGCCAGGAGCAACGGCGCAT
TCGCCGGCGCCAGTGGGCAGGGGCGCTGGCCGCGTCGCTGGTTATCGGTGCGGCGGGAGGGTTGTGGGCA
AACAGTTACACGCTCAATCAGCAGCGTCTGACGCAGTTGCAGGCACTGACCGTAGAACCACCGGTGACGG
ACGGTACGCTGGAGGCGTTGCCGCTATTGGACGCGCGCCTTGCGGCAACCGGGGTTTTTCCTCCAGCGCA
GGAGGTCGGTTGGGTGGAGCGTGCTGGGCTGTATCAGGGCGCGGCGAGCCGGCCGACGCTGATCGATGCC
TACGCGCAATCCCTGCAACGGCAATTATTGCCCCGCGTGGCTGCGTTGCTTGAAGAGCAGGTGCGTAACA
CTCTCGGTGACCGTGAGCGCTTGCTGGACAACCTGCGCGCCTACCTGATGCTGGCGCTGCCGCAACGTCG
TGACAACCCGTGGCTGGCGCAGCATATGGCCGCGCTATGGTCTGCACGCCACGCCGCCGATGGTTCGGCG
CAGAAGCGCTTGAACCTGCACCTGGCAAGCTTGCTGGGGCAAGACTTCGTGGCGCCGCTTGACGATGATC
TGGTGGCACAGGCGCGCCAGGCCTTGCGCGGTGAGTCCCTGACCGATGTGGTTTATCGGACGCTGCGAGA
GCAGGCGCGCAATCTGGAGCCTTTGCGGCTTGCCGAGGGCAGTGTGTTCGCTGCGATCGATCAGCCAATA
CCGGGGTTCTACAGCAAAAAATACTGGCAGTATTTCGAGGCGCAGGGTGCGCGCCTGGTGAACGCCATCG
CTCAGGATAACTGGGTACTCGGTGAGGCGAGCGACCTCAGCGCCATGGACCTGCGCCGGCTGATGCTCGA
ACTGGAACAACGCTACTTCAGCGAGTACGCCGACGTCTGGAGCGAGGCGCTGGGGCGTATTCGGCTACAG
GAGATCGATAGCCTCAAAAGCGCTGCCGAGCAATTTGCCAGCCTCACATCGGCGCAGTCGCCACTGGTGC
AGATGTTGCAACAGGTCAGGGAAAATACCCGGTTGTCGCCCGCGAGCGAGCGCCTTGGTGAGGTCGCCGC
TCAGGTCGGGGCGCTCGGCGCGAAGGTCGAGGCGGCAGGCGCGATGTTGACCAGCCCATTGCAGGGGCTT
ACCCAGGCGGATACCGCTCGACGCGCATTGCAACGACGTTTTGAGCCCTTGCACCAGTTGCTCGATGAGC
AGCACAACCCTGGCACTGCGGTGAGCCATGTGTTGCAACTGTCCGATCAGTTGCAGTTGCAACTGGGGAC
GCTGACTCGGGAAAGTTCGTCGGAGCAGGCGGTGTTCAACAGGGTCAAGCGCCGCATGGATGGCCAACAG
GACCTGCTTGGTGATTTGCGCGAAAGCGCCGCCCGGCTGCCACTGCCGCTGTCCACGTGGTTCGGCGCGA
TTGCGGATGACACCTGGCAACGCCTGCTGGAGGAGGCCTACGTACACGTGAACCAGCGTTATCAGAGTGA
GGTGTACAGCGTTTACGCCAAGGCCATTCGCCAGCGGTACCCGTTCAATGCCAGCGCGGGTAGCGATGTC
GCTCTCAGTGACTTTCAGGAATTCTTCGGGCCCCAGGGCGTGCTGGCAAGGTTCCAGGAGACTTACCTGC
GGCCTTTTATCAGCGCTGATGGCAGCCGACACCGTTTGCGGGGCATCGACGGTCGCAGTTTGCCTGTGTC
GCGCTCGCTGCTGGATCAACTGAGCAAGGTGCAACTCATCCGGCGCAGTTTTTTCAGTGAGCAGGGCGAG
TTGTCGGTGCGCTTCAGTCTGGCGCCCTACAGCCTGGATCAGGCGGTCAATCGCGCGATTCTGCGCCTGG
GCACTCAGCAGTTGGAGTATCGCCATGGGCCCATCGTCCCCATGGTGTTCCAGTGGCCTGTGGAGAGTGA
CAATGGTCGCAGCAGCTTGGTACTGGAGCGGGGCGCCGAGCGGCCGTTGGGTATCGAGAAGAATGCCGGG
GCCTGGTCGGTGTTCAGGCTGTTTGACCTGATGCAAAGCGAGCCCGCAAGCGGTCGGGATGCGCAATTGC
TGAAGTCCGACCTCGCAGGCTTGCGCGCCAATTACCTGTTGACCAGTCAGCGCACGCCCAGCCCGTTCCA
GATGGCGGACTGGCGCACCTTCCGGTTGCCGGAGCAACTGTGA
 Primer design