SecReT6
Protein ID: 447916369
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06845
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1488572..1489291 [+]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDM4JZ16
KEGG IDppz:H045_06845
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 2.80E-16, Aligned region: 15..202
PP2C [PF00481], Evalue: 1.30E-13, Aligned region: 32..200
SpoIIE [PF07228], Evalue: 2.00E-11, Aligned region: 36..239
Protein Sequence: 239 a.a.     [Download]
>gi|447916369|ref|YP_007396937.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas poae RE*1-1-14]
MSQAAARWRSAGHTRRGKDRSRNEDALLDCPERGCWAVADGMGGHRAGDVASQSVVSSLASMAGHGDLDQ
RVGAVRRCLQEVNRQLLNTAQGPQDVIGSTVVALLLEGDRAACVWAGDSRCYLWRGQSLYQLSRDHSRMR
QLMEEHRMNAQQAGAQPDARALTRAVGAHERLHLEVLELGTCPGDVFLLCSDGVYQTLDHGELGRALSLD
TPQHMLDRVFESVLRGAARDDLTAVVIQR
 
Nucleotide Sequence: 720 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1488572-1489291 Pseudomonas poae RE*1-1-14, complete genome
GTGAGCCAGGCAGCTGCGCGCTGGCGCAGTGCCGGTCATACGCGACGCGGCAAGGATCGTTCACGCAATG
AGGACGCATTGCTCGACTGCCCCGAGCGGGGGTGCTGGGCGGTCGCGGACGGCATGGGGGGACATCGCGC
CGGGGACGTGGCCAGCCAGTCTGTGGTGAGCAGCCTGGCGTCAATGGCTGGCCATGGCGACCTTGATCAG
CGCGTGGGCGCTGTCCGGCGCTGCCTGCAAGAGGTCAACCGGCAACTGCTAAATACGGCGCAGGGTCCGC
AGGACGTTATTGGCAGCACCGTTGTAGCCCTGCTGCTGGAAGGTGATCGCGCGGCATGTGTCTGGGCGGG
GGACAGCCGCTGCTATCTGTGGCGTGGGCAGAGTCTTTACCAACTGTCCCGGGATCATTCGCGGATGCGG
CAACTGATGGAAGAGCACCGGATGAACGCGCAGCAGGCCGGCGCCCAGCCGGATGCCAGGGCCCTGACCC
GTGCGGTTGGCGCGCACGAGCGCTTGCATCTTGAGGTGCTGGAACTCGGTACATGCCCTGGCGATGTATT
TCTGCTGTGCAGCGACGGTGTCTACCAGACACTCGACCATGGCGAACTGGGCCGGGCACTGAGCCTGGAT
ACGCCGCAACACATGCTGGATCGCGTGTTTGAGTCGGTATTGCGCGGCGCGGCGCGGGACGACCTCACGG
CCGTGGTAATCCAGCGATGA
 Primer design