SecReT6
Protein ID: 447916370
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06850
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1489288..1490124 [+]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDM4K1I0
KEGG IDppz:H045_06850
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 7.70E-34, Aligned region: 15..228
Pkinase_Tyr [PF07714], Evalue: 8.10E-19, Aligned region: 16..225
APH [PF01636], Evalue: 0.00074, Aligned region: 126..167
APH [PF01636], Evalue: 0.00074, Aligned region: 208..242
Protein Sequence: 278 a.a.     [Download]
>gi|447916370|ref|YP_007396938.1| serine-threonine kinase Stk1 [Pseudomonas poae RE*1-1-14]
MTAPLCPGDLLAGRYQLERVLGIGGMGVVYRARDLLHEQFGEPRSSVALKVLGECFSECPDAHVLLYSEF
SLTRSLLHPGVVRMFGFDVDTRRQLAFFTMELMHGMTLDRLLLERPAGFGWHEWQPMALQLLDALAYAHG
QGVLHGDVKPGNVMVGEAGIRLFDFGLGQSQAMTGLPGMDRHRISAWTPAYVAPELLEGAELSASADVYG
AACVLYQMAQGRRPGERNPTHVLNRPRQLPRHCWPALRTALAMDPAQRTITVAEVREALAGRSWRWLA
 
Nucleotide Sequence: 837 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1489288-1490124 Pseudomonas poae RE*1-1-14, complete genome
ATGACAGCGCCTCTGTGCCCCGGCGACCTGCTCGCGGGTCGCTATCAGCTCGAGCGCGTGCTGGGCATCG
GAGGTATGGGCGTGGTCTACCGCGCCCGCGACCTGTTGCATGAGCAGTTCGGTGAACCTCGGTCCAGCGT
TGCGTTGAAAGTACTCGGCGAGTGTTTTTCCGAATGCCCGGATGCCCATGTGCTGCTGTACAGCGAGTTC
TCCCTGACACGCAGCCTTTTGCACCCGGGGGTGGTGCGCATGTTCGGCTTCGATGTCGACACCCGCCGGC
AGTTGGCGTTTTTCACCATGGAATTGATGCACGGCATGACCCTGGATCGACTCCTGCTGGAGCGTCCCGC
CGGCTTCGGCTGGCACGAGTGGCAGCCAATGGCCCTGCAACTGCTGGACGCATTGGCTTATGCCCATGGG
CAGGGCGTGCTGCATGGTGACGTGAAGCCGGGCAATGTCATGGTGGGGGAGGCGGGGATACGTCTGTTCG
ATTTCGGCCTGGGCCAGTCGCAGGCAATGACAGGGCTGCCCGGTATGGACCGTCATCGCATCAGCGCCTG
GACGCCTGCTTATGTCGCGCCAGAGCTGTTGGAGGGGGCAGAGCTGTCAGCGTCGGCAGATGTTTATGGC
GCAGCATGCGTGTTGTATCAGATGGCACAAGGGCGGCGTCCGGGCGAGCGCAATCCCACTCATGTGCTCA
ACCGACCCCGCCAGCTGCCGCGCCATTGCTGGCCAGCCTTGCGCACGGCGCTGGCGATGGACCCGGCGCA
GCGAACGATCACGGTCGCCGAAGTGCGCGAGGCGCTGGCTGGCCGCTCATGGCGCTGGCTTGCCTAG
 Primer design