SecReT6
Protein ID: 447919061
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20355
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4617815..4620787 [-]
Productserine/threonine protein kinase PpkA
NotePpkA
UniProt IDM4K4U0
KEGG IDppz:H045_20355
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 1.70E-48, Aligned region: 9..250
Pkinase_Tyr [PF07714], Evalue: 2.00E-32, Aligned region: 11..213
VWA_2 [PF13519], Evalue: 4.10E-10, Aligned region: 116..152
VWA_2 [PF13519], Evalue: 4.10E-10, Aligned region: 573..750
VWA_2 [PF13519], Evalue: 4.10E-10, Aligned region: 829..882
APH [PF01636], Evalue: 1.00E-06, Aligned region: 14..121
APH [PF01636], Evalue: 1.00E-06, Aligned region: 122..150
APH [PF01636], Evalue: 1.00E-06, Aligned region: 240..305
Kinase-like [PF14531], Evalue: 0.00017, Aligned region: 119..211
Protein Sequence: 990 a.a.     [Download]
>gi|447919061|ref|YP_007399629.1| serine/threonine protein kinase PpkA [Pseudomonas poae RE*1-1-14]
MNILIPGYDIDGEIGEGAMASVYLATQRSLERKVALKVMAAALAADPSFCERFLREGRTLARLSHPHTVT
IHDIGNVGELYYMAMEYLPNGTLKERIAAGMTPQQGVTLIRQIASALGYAHAQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILVGKLPYTGTD
ALSTALAHLTEPLPELPVHHGRYQGVLRKLLAKDPAERFADAAALLVALDQLPMDSPEATLVRPLPMPMS
FDLAGITPESIEIPTARPQPQVVRQPVVTPTQHRAVSEQRRGPVLALAAVAVAVALAIGGASFWWLSGSD
EPARPPAAAVPKAVTPPAAVAEVDGGQRPLLMAGKKTLFQRVLSKPGAKLASEAGGASGKALPAFSVLYV
YQRKAVGGQPWVRVGAATDGRSDGWLPASQVSDWKQSLVLKFTERSGRAPVMFLRQPGEVEKLLADPSAA
KNALANAQKNSDDNQQVLALEPAASAVPQNQFYLLPIFDSKESFDENGQPVQLLNVASIDPGSSAVARPA
APAVNADAFRTAVVMVVDTTVSMQPYIDQIRDVVHELQTRIAERGELDSVSFGLVGFRNSIKKTPGLEYV
AKTLISLDQGRDPQRFLDMARQVKASTVSSHSFNEDAFAGVMQAVEGMDWSGYGGRIILLVTDAGALRKN
DPFAATQMNEAEVRQAALGKQIKIYALHLRTDAGKKTHAGAESQYRILTADANPKIGDLYTPVPGGDVHK
LGERVDEIGTVFANLVHQVRSNTPQPVPLLGAAPSLADKSAAVGYAMHMDFLGRKTASQAPQLVSAWTAD
RDLTNPALPAFQVCVMLTKLQLNDLQQSLKLIVDAARKTQTSPKDFFQEIASASAYMSRDPQALRKGGNL
ADGGILGEYLEGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELDSKIRLYETFHNDVANWVRFGDAEPGDA
LYRVPLSTLP
 
Nucleotide Sequence: 2973 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4620787-4617815 Pseudomonas poae RE*1-1-14, complete genome
ATGAACATCCTGATCCCCGGTTACGACATCGACGGCGAGATTGGCGAAGGCGCCATGGCCAGCGTGTACC
TGGCAACCCAGCGCTCGCTGGAGCGCAAGGTCGCCCTGAAAGTGATGGCGGCGGCGCTGGCGGCTGATCC
GAGTTTCTGCGAGCGCTTTCTGCGCGAGGGCAGGACCCTGGCGCGGCTGTCGCACCCGCACACCGTGACC
ATCCATGACATCGGCAATGTCGGTGAGCTGTATTACATGGCCATGGAATACCTGCCCAACGGCACGCTCA
AGGAGCGCATCGCCGCCGGCATGACGCCGCAGCAGGGGGTGACGCTGATCCGTCAGATCGCCTCGGCGTT
GGGGTATGCCCATGCCCAGGGCCTGGTGCACCGTGATGTCAAACCGGCGAACATCCTGTTTCGCGCCGAC
GGCACGGCGGTGTTGTCGGACTTCGGCATCGCCAAGTCCCTCGACGACCGCACCCAGTTCACCCAGGCCG
GGTTTGCCGTGGGCACGCCGAGCTACATGAGCCCGGAACAGGCGCGGGGCCAGGAGATCGATGGCCGCGC
CGACCTTTACGCGCTGGGCGTGGTGCTCTACGAAATCCTCGTCGGCAAGCTGCCCTACACCGGTACCGAC
GCACTCTCCACGGCGCTGGCGCACCTCACCGAACCGTTGCCGGAATTACCGGTGCACCACGGGCGTTATC
AGGGTGTACTGCGCAAGCTGCTGGCCAAGGACCCGGCCGAGCGATTCGCTGATGCGGCGGCGTTGCTGGT
TGCGCTCGATCAACTGCCGATGGACTCCCCGGAGGCCACCCTGGTGCGGCCGCTGCCGATGCCGATGAGT
TTCGACCTGGCGGGTATCACACCCGAATCCATCGAGATCCCGACCGCCAGGCCGCAGCCGCAAGTGGTAC
GCCAGCCGGTGGTGACGCCGACCCAGCATCGCGCGGTGTCCGAACAGCGCCGTGGGCCGGTATTGGCCCT
GGCCGCCGTGGCGGTTGCCGTGGCGCTGGCCATTGGCGGCGCGAGTTTCTGGTGGTTGAGCGGCAGCGAT
GAGCCGGCCAGGCCGCCGGCGGCCGCAGTGCCCAAGGCCGTCACGCCACCTGCGGCGGTGGCCGAGGTGG
ATGGCGGCCAGCGCCCGCTGTTGATGGCTGGCAAAAAGACCCTGTTCCAGCGCGTACTCAGTAAGCCCGG
AGCAAAACTGGCAAGCGAAGCAGGCGGTGCATCCGGCAAGGCGCTGCCGGCGTTCTCCGTGCTCTACGTG
TACCAACGCAAGGCGGTCGGCGGTCAGCCCTGGGTGCGCGTTGGCGCCGCCACCGATGGGCGCAGCGACG
GTTGGTTACCGGCCTCCCAGGTCAGCGACTGGAAACAGAGCCTGGTGCTCAAGTTCACCGAACGTTCGGG
CCGTGCACCGGTGATGTTCCTGCGCCAGCCCGGCGAGGTGGAGAAGCTGCTGGCGGACCCGTCCGCCGCG
AAAAATGCCCTGGCCAACGCGCAGAAAAACAGCGATGACAATCAACAGGTGCTGGCTCTTGAGCCTGCCG
CCAGCGCCGTGCCGCAGAACCAGTTCTACCTGTTGCCGATCTTCGATTCCAAAGAGAGCTTCGACGAAAA
CGGCCAGCCGGTGCAGTTGCTCAACGTAGCGTCCATTGACCCCGGCAGCAGCGCCGTAGCGAGGCCCGCC
GCGCCTGCGGTCAACGCCGATGCCTTCCGCACGGCTGTGGTGATGGTGGTGGATACGACCGTGTCGATGC
AGCCCTACATCGACCAGATTCGCGACGTGGTGCACGAGCTGCAAACCCGCATCGCCGAGCGCGGCGAGCT
GGACAGCGTCAGCTTCGGCCTGGTGGGCTTTCGCAACAGCATCAAGAAAACCCCCGGCCTGGAATACGTG
GCCAAGACCCTGATCAGCCTCGACCAGGGGCGTGACCCGCAGCGGTTTCTCGACATGGCACGCCAGGTCA
AGGCGTCCACGGTATCGAGCCATTCGTTCAACGAAGACGCGTTTGCCGGGGTGATGCAGGCGGTGGAAGG
CATGGATTGGTCCGGCTATGGCGGGCGTATCATCCTGCTGGTGACCGATGCGGGCGCACTGCGCAAGAAC
GATCCGTTCGCCGCCACGCAGATGAACGAAGCCGAAGTGCGCCAGGCCGCGCTGGGCAAGCAGATCAAGA
TCTACGCCTTGCACCTGCGCACCGATGCCGGCAAGAAAACCCATGCCGGCGCCGAGAGCCAGTACCGCAT
CCTCACGGCTGACGCCAACCCGAAGATCGGCGACCTGTATACGCCGGTGCCGGGTGGCGACGTGCACAAG
CTCGGCGAGCGCGTGGATGAGATCGGCACGGTGTTCGCCAACCTGGTGCACCAGGTGCGCAGCAACACGC
CGCAGCCGGTGCCATTGCTGGGCGCCGCACCGAGCCTGGCGGACAAGTCGGCGGCCGTCGGTTATGCGAT
GCACATGGATTTCCTGGGCCGCAAGACCGCGAGCCAGGCACCGCAACTGGTGAGTGCATGGACCGCCGAC
CGTGACCTCACCAACCCGGCGCTGCCGGCGTTTCAGGTGTGCGTGATGCTGACCAAGTTGCAGCTCAACG
ACCTGCAACAGTCGCTGAAACTGATCGTCGATGCGGCGCGCAAAACCCAGACCTCGCCTAAAGACTTCTT
CCAGGAAATCGCCAGCGCCTCGGCCTACATGAGCCGCGACCCGCAAGCCCTGCGCAAGGGCGGCAACCTG
GCCGACGGTGGCATTCTTGGCGAATACCTGGAGGGTCTGCCGTACCGCAGCAAGTCGCTGAACATGACCC
AGGACTTGTGGTTGTCGTTGAGCGTGGCCGAGCAGGAAGACTTTATCGACGAGCTGGATTCGAAAATCCG
CCTCTACGAAACCTTCCACAATGATGTGGCCAACTGGGTTCGATTCGGCGATGCCGAGCCGGGCGATGCG
TTGTACCGCGTGCCTTTGTCGACGCTGCCGTGA
 Primer design