SecReT6
Protein ID: 447919062
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20360
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4620784..4621503 [-]
Productputative phosphatase
NotePppA
UniProt IDM4K572
KEGG IDppz:H045_20360
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 6.20E-13, Aligned region: 16..203
PP2C [PF00481], Evalue: 7.60E-13, Aligned region: 25..230
SpoIIE [PF07228], Evalue: 1.00E-06, Aligned region: 33..237
Protein Sequence: 239 a.a.     [Download]
>gi|447919062|ref|YP_007399630.1| putative phosphatase [Pseudomonas poae RE*1-1-14]
MGATYKSASKSHVGMVRQVNEDACLDLPENRLWVVADGMGGHAAGDYVSSLIVDSLRSVAMGRSLDEYTA
ALRNDLVRINTAVREETANRGVSLMGSTVVVLAARGLRGVCLWAGDSRLYRLRDGVLDSISRDHSYVQDL
QDSGLLSEADARTHPRANIVTRAVGVEAQLNLAAVELLIAPGDSYLLCSDGLTKTVEDHEIRDVLGHNAP
DEIVRSLVHLGLNRGAPDNITAIVVKVSA
 
Nucleotide Sequence: 720 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4621503-4620784 Pseudomonas poae RE*1-1-14, complete genome
ATGGGGGCGACGTACAAATCCGCGAGCAAAAGCCATGTGGGCATGGTGCGCCAGGTCAATGAAGACGCGT
GCCTGGACCTGCCGGAAAACCGCCTGTGGGTGGTGGCCGACGGCATGGGCGGGCATGCGGCCGGCGACTA
TGTCAGCAGCCTGATCGTCGACAGCCTGCGCAGTGTGGCGATGGGCCGTTCCCTCGACGAATACACGGCT
GCGCTGCGCAACGACCTGGTCCGTATCAACACGGCCGTGCGTGAAGAAACCGCCAACCGTGGCGTCAGCC
TGATGGGCAGCACCGTGGTGGTGCTCGCCGCCCGTGGCCTGCGCGGCGTGTGCCTGTGGGCTGGCGACAG
TCGCCTGTATCGCCTGCGCGACGGCGTGCTCGACAGTATCTCCCGTGACCACAGCTACGTGCAGGACCTG
CAGGACAGCGGCCTGCTCAGCGAAGCCGATGCCCGCACACATCCGCGCGCCAATATCGTCACCCGCGCCG
TGGGCGTGGAGGCCCAGTTGAACCTGGCGGCGGTCGAGCTTTTGATCGCCCCCGGCGACAGCTACCTGTT
GTGCAGCGACGGCCTGACCAAGACCGTCGAAGACCATGAAATCCGCGACGTGCTCGGTCACAACGCACCC
GATGAAATCGTGCGCAGCCTGGTGCACCTGGGGCTCAACCGGGGCGCGCCGGACAACATCACCGCCATTG
TCGTGAAGGTGTCGGCATGA
 Primer design