SecReT6
Protein ID: 447919063
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20365
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4621504..4622157 [-]
Producttype VI secretion-associated protein TagF
NoteTagF
UniProt IDM4KBN7
KEGG IDppz:H045_20365
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 3.10E-49, Aligned region: 5..142
DUF2094 [PF09867], Evalue: 3.10E-49, Aligned region: 200..209
Protein Sequence: 217 a.a.     [Download]
>gi|447919063|ref|YP_007399631.1| type VI secretion-associated protein TagF [Pseudomonas poae RE*1-1-14]
MTTLGFYGKLASRGDFVSRTLPQSFVGPWDSWLAAGLLASQNSLGGDWLNVYLVSPLWRFVLSPGVCGPD
AAAGVVMPSIDRVGRYFPLAVVALLDHDTNPASLVGGPDAWFEQAEELLLSTLDAGATFEGFNAGLDRLG
VPATEPRAVDSRFAGLQRMAATLPHGRLAALAEQACEGASLWWGRGSQRIAPGLLRCQGLPATGDFAQFL
LGQEGVV
 
Nucleotide Sequence: 654 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4622157-4621504 Pseudomonas poae RE*1-1-14, complete genome
ATGACGACCCTGGGTTTCTACGGCAAGTTGGCCAGCCGTGGCGATTTTGTCAGCCGTACCTTGCCTCAGA
GTTTTGTCGGCCCGTGGGACAGCTGGCTGGCGGCGGGCCTGCTCGCCAGCCAGAACAGCCTGGGCGGCGA
CTGGCTCAATGTGTATCTGGTCAGCCCGTTGTGGCGCTTTGTGCTGTCGCCGGGCGTATGCGGGCCGGAT
GCAGCGGCGGGTGTGGTGATGCCCAGCATTGATCGGGTGGGGCGCTATTTCCCGCTGGCGGTGGTGGCCT
TGCTCGATCACGACACCAACCCGGCCTCGCTGGTGGGCGGGCCGGATGCCTGGTTCGAACAGGCCGAAGA
GCTGTTGCTGAGCACCCTGGATGCGGGTGCCACGTTCGAAGGTTTCAACGCAGGGCTCGACCGGCTTGGC
GTACCGGCGACCGAACCGCGTGCGGTCGACAGCCGTTTCGCCGGCCTGCAACGGATGGCCGCCACCTTGC
CTCACGGGCGACTGGCCGCGCTGGCCGAACAGGCCTGCGAGGGTGCCAGCCTCTGGTGGGGCCGTGGTTC
GCAGCGGATCGCTCCCGGGTTATTACGGTGCCAGGGCCTGCCTGCCACCGGCGATTTTGCGCAATTTTTG
CTCGGACAAGAAGGTGTGGTGTAG
 Primer design