SecReT6
Protein ID: 447919064
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20370
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4622154..4625654 [-]
Producthypothetical protein
NoteTssM
UniProt IDM4K6I4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.50E-97, Aligned region: 78..122
ImcF-related_N [PF14331], Evalue: 8.50E-97, Aligned region: 188..450
IcmF-related [PF06761], Evalue: 1.20E-89, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 7.40E-41, Aligned region: 689..724
DUF1215 [PF06744], Evalue: 7.40E-41, Aligned region: 904..1025
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 619..640
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 769..838
AAA_19 [PF13245], Evalue: 0.0045, Aligned region: 124..141
Protein Sequence: 1166 a.a.     [Download]
>gi|447919064|ref|YP_007399632.1| hypothetical protein H045_20370 [Pseudomonas poae RE*1-1-14]
MKAFFSFMIRWVIPLLGLIALSLIIWFVGPLLDVLVPEGRRWALIILVFAVWVAYRVWRIVQARRQAAEV
LRSLAADTPADPNSLATAEELSTLRQRMDEALTLLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSNSTVDKAAWLGFLDLLKKQRSRR
PIDGAFIAISLSDLLLGTDAERAAHAAAIRLRIQELYSQLGVRFPIYLMLTKLDLVPGFMEFFDNLSKED
RAQVWGMTFALDDGKNSDSPLAHLQNEFAGLEQRLNERLVERLQQERDPARRDLIYGFPQQFGALKDCLQ
GFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQSGTGRSYFIEKLFTAV
AFAERGLVGVNPKVERRRKWIARGVLAATVALVVVVSGLWWVSYRANQAYIAQVDQKVTPLGQTVQNLSP
AQRDVLAVLPLLNAVKNLAGDSPGWSEGLGLYQGDMLEAESASVYRKLLIAVFAPRLVTRIEEQLHGGGN
SDFLYEGLKAYLMLADSEHYDADFIKAWIALDWDRNLPRDLPADQRQALIGHLQALFDRHPPNARLDPRL
IDDLRRQLQQLPVAQRVYDRVKRQKLPDGIPDFRLSEAAGRDAALVFSRKSGKPLGEPLSGFFTAKGYRQ
AFLLSSLNQTGTLAEEQWVLGNEPADQQNVVSLAADVRRLYFQDYQRQWDALLADIDFVPITSVAQAADV
LRVISGPTSPLKKLLVAVARETDLQAEERQLVAKGVPVEGGVDKLKERLGSLLGQEQPAANAPAAADDPV
TAHFAQLNSIVSKNEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQAAAAATRVSLNAERQPP
LVQGMVKSVVNATTNSMMGGVRNQLNAAWVSEVVNVYRQSLAGRYPMSPGSARDATLDDFGQFFGVGGVM
DNYFRKYLQPYVDTSSQTWRWQPGAAQKLGIAPGVLQTFQRAAAIRDAFFRAGGTQPIVRFELKPVSMDP
TITQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRISIMPPSASGRSGVTLDGPWAWFRLLEQSDLT
AGNSPDRFNLRLRVDGASIAYELRANSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3501 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4625654-4622154 Pseudomonas poae RE*1-1-14, complete genome
GTGAAGGCGTTTTTCAGTTTCATGATTCGCTGGGTGATCCCGCTGCTGGGCCTGATCGCCCTGAGCCTGA
TCATCTGGTTTGTCGGGCCGTTGCTCGACGTGCTGGTGCCGGAAGGACGCCGTTGGGCGCTGATCATCCT
GGTGTTCGCGGTATGGGTCGCCTACCGCGTGTGGCGCATCGTCCAGGCCCGCCGGCAGGCCGCCGAAGTG
CTGCGCAGCCTCGCGGCCGACACCCCGGCCGATCCCAACAGCCTGGCCACTGCCGAGGAATTGTCGACCC
TGCGCCAGCGCATGGACGAAGCGTTGACGTTGCTGAAAAAAGCCAAACTTGGCGGTGATGAGCGGCGCAA
CCTCTACGAGCTGCCGTGGTACGTGATCATCGGCCCGCCGGGTTCGGGCAAGACCACCGCGCTGGTCAAT
TCCGGCCTGCACTTTCCGCTGGCCGCCCAACTTGGCGCTGGCGCGGTGCGCGGGGTTGGCGGTACGCGCA
ATTGCGACTGGTGGTTTACCGATCAGGCAGTATTGCTCGACACCGCCGGCCGCTACACCACCCAAGACAG
CAACTCGACGGTGGACAAGGCCGCCTGGCTGGGCTTTCTCGACCTGCTGAAAAAGCAGCGCTCGCGTCGC
CCCATCGACGGTGCGTTCATCGCCATCAGTCTGTCGGATTTGCTGCTGGGCACTGACGCCGAGCGCGCCG
CCCATGCCGCCGCGATCCGCCTGCGTATCCAGGAGTTGTACAGCCAATTGGGCGTGCGCTTTCCGATCTA
CCTGATGCTGACCAAGCTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAACCTGAGCAAGGAAGAC
CGCGCCCAGGTGTGGGGCATGACCTTTGCCCTGGACGATGGAAAGAACAGCGACAGCCCGCTGGCCCATC
TGCAGAATGAATTTGCCGGTCTGGAACAGCGTCTCAACGAACGCCTGGTGGAGCGCCTGCAACAGGAACG
CGACCCGGCACGGCGCGATCTCATCTACGGCTTCCCGCAGCAGTTCGGCGCGCTGAAGGATTGCCTGCAA
GGCTTCCTCGAAGGCGTGTTCAAGCCCAATGCGTTCGAAGAGCGCGTGTTGCTGCGCGGTGTGTACTTCA
CCAGCGGCACCCAGGAAGGCAGCCCGATCGATCGCCTGATCGGTGCGATGGCCCAGAGCATGAACCTGGA
CCGCCAGCACCTGGCACGCCAGAGCGGCACCGGGCGCAGTTACTTCATCGAAAAACTGTTCACCGCCGTG
GCGTTTGCCGAGCGCGGACTGGTCGGCGTGAACCCGAAGGTCGAGCGGCGGCGCAAATGGATTGCACGCG
GTGTGCTGGCGGCCACCGTGGCGCTGGTGGTGGTCGTCAGCGGCCTGTGGTGGGTGAGCTATCGCGCCAA
TCAGGCCTACATCGCCCAAGTTGACCAGAAGGTCACGCCCCTGGGCCAGACCGTGCAGAACCTCAGCCCG
GCACAGCGCGACGTGCTCGCCGTGTTGCCGCTGCTCAATGCGGTGAAGAACCTGGCAGGCGACTCGCCCG
GTTGGTCCGAGGGGCTGGGGCTGTATCAGGGCGACATGCTCGAAGCCGAATCCGCCAGCGTCTACCGCAA
GCTGCTGATCGCCGTGTTTGCGCCCCGTCTGGTGACGCGCATCGAAGAGCAACTGCACGGCGGCGGCAAT
TCGGATTTCCTCTACGAAGGCCTCAAGGCCTACCTGATGCTGGCCGACAGCGAGCATTACGACGCGGATT
TCATCAAGGCCTGGATCGCGCTGGACTGGGACCGCAACCTGCCGCGAGACCTGCCGGCCGATCAGCGCCA
GGCGCTGATCGGACATTTACAGGCGCTGTTCGACCGCCATCCGCCGAATGCGCGACTGGACCCGCGTTTG
ATCGACGACCTGCGCCGCCAGTTGCAGCAACTGCCGGTGGCCCAGCGCGTGTATGACCGGGTCAAGCGCC
AGAAACTGCCCGACGGCATACCCGACTTTCGCCTTAGCGAGGCAGCCGGACGCGATGCTGCGCTGGTGTT
CAGCCGCAAGAGCGGCAAGCCACTGGGCGAGCCATTGAGCGGCTTTTTCACCGCCAAGGGCTACCGTCAG
GCGTTCCTGCTGAGCAGCCTGAACCAGACCGGCACCCTGGCTGAAGAGCAATGGGTGCTGGGCAATGAAC
CGGCCGATCAACAGAACGTGGTGAGCCTGGCCGCCGACGTGCGCCGTCTGTACTTCCAGGATTACCAGCG
CCAGTGGGATGCGTTGCTTGCGGATATCGACTTCGTACCGATCACCAGCGTGGCCCAGGCGGCGGATGTG
CTGCGGGTGATCTCCGGGCCGACGTCGCCACTGAAAAAACTGCTGGTGGCGGTGGCCAGGGAAACCGACC
TGCAAGCCGAAGAGCGTCAGCTGGTGGCCAAGGGCGTACCGGTAGAAGGCGGCGTCGACAAGCTCAAGGA
GCGCCTGGGCAGCCTGCTCGGCCAGGAACAGCCGGCCGCCAATGCCCCGGCGGCGGCGGATGATCCAGTG
ACCGCGCATTTTGCCCAGCTCAACAGCATCGTCAGCAAAAACGAAGGTGAACCGGCTGCCATCGACGGCC
TGCTCGCGGACATGAACGCGCTGTATGTGCAGGTCAGTGCGATGGTTGGCGCCAGTGGCGATGCGCTGCT
GGGCGAGGCGAAGAACCAGGCGGCCGCTGCGGCCACGCGGGTCAGCCTGAATGCCGAGCGTCAGCCGCCG
CTGGTGCAGGGCATGGTCAAGTCGGTGGTCAACGCTACCACCAACAGCATGATGGGCGGGGTGCGTAACC
AGCTGAACGCGGCCTGGGTCAGCGAGGTGGTCAATGTGTACCGCCAGTCATTGGCCGGGCGCTACCCGAT
GTCGCCGGGCAGCGCGCGTGACGCGACCCTGGATGACTTCGGCCAGTTCTTCGGCGTGGGCGGGGTGATG
GACAACTACTTTCGCAAGTACCTGCAGCCTTACGTGGATACATCGAGCCAGACCTGGCGCTGGCAGCCGG
GCGCGGCGCAGAAGCTCGGCATTGCGCCGGGCGTGCTGCAAACCTTCCAGCGTGCGGCGGCGATTCGTGA
TGCGTTTTTCCGCGCCGGGGGCACCCAGCCGATCGTGCGCTTTGAGCTCAAGCCGGTGTCGATGGACCCG
ACCATCACCCAATTTCTGCTCGACCTCGACGGCCAGCAATTGAGCTACGACCACGGCCCGAGTCGTCCGG
TGGCCATGCAATGGCCCAATCCCGGCAGCATTGGCGTGGTGCGTATTTCCATCATGCCGCCGTCAGCCAG
TGGCCGTTCCGGTGTGACCCTGGACGGCCCGTGGGCCTGGTTCCGCCTGCTGGAGCAATCAGACCTTACC
GCAGGCAATTCGCCGGACCGTTTCAACCTGCGCCTGCGGGTTGACGGTGCGAGCATCGCCTACGAACTGC
GCGCCAACAGTGCGTTCAACCCGTTCAAAAGCCGCGTACTCAGTGGCTTCAGCCTGCCGGAGCGGCTATG
A
 Primer design