SecReT6
Protein ID: 447919065
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20375
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4625651..4626940 [-]
Producthypothetical protein
NoteTssL
UniProt IDM4K8Z7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.20E-71, Aligned region: 46..251
OmpA [PF00691], Evalue: 1.90E-15, Aligned region: 319..417
DUF883 [PF05957], Evalue: 0.00077, Aligned region: 71..119
DUF883 [PF05957], Evalue: 0.00077, Aligned region: 181..248
DUF883 [PF05957], Evalue: 0.00077, Aligned region: 314..353
Protein Sequence: 429 a.a.     [Download]
>gi|447919065|ref|YP_007399633.1| hypothetical protein H045_20375 [Pseudomonas poae RE*1-1-14]
MHPNDDDRTQFMPRPGGRAPEPARAEPAPLAMPAAPILTGKSQGLNPLESAAGPLLALLTRLRNTIAHPA
PASLRAQLLAYLRQFEERAEAAGIPRNEVLLARYALCTALDEAVLSTPWGSTSDWGKQSLLITVHNEAWG
GEKVFQLLDHCLQSPRERLYLLELLYLCLCLGFEGRYRVMNDGRSQLEALRERTAAAIRSARGEHERELS
PHWRGVTVARDRLAQFMPPWIAVAIGLALLLALLFGLRLKLAADAEPVFKNIHALGEIPVQAIDRPVAQP
KVIERPRLAGFLAEDIKAGRVAVEDKVDRSVVTIKGDELFASASASIVDNYQPLMLRIADAIRKVKGQVR
VTGHSDNRPIATLRFPSNWALSEARAKSVLEILAAKTGQAERFSAEGRSDTEPLATNATAEGRARNRRVE
ITVLAEGVE
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4626940-4625651 Pseudomonas poae RE*1-1-14, complete genome
ATGCATCCCAATGACGATGACCGCACCCAGTTCATGCCGCGACCGGGTGGCCGCGCGCCGGAACCTGCGC
GTGCCGAGCCTGCCCCGTTAGCGATGCCGGCGGCGCCGATTCTCACCGGCAAAAGCCAAGGCCTCAACCC
GCTGGAAAGCGCTGCCGGCCCGCTGTTGGCCCTGCTGACGCGCCTGCGCAACACCATCGCCCACCCGGCG
CCGGCCAGCCTGCGCGCGCAGTTGCTGGCCTACCTGCGTCAGTTCGAAGAGCGCGCAGAAGCCGCTGGCA
TTCCGCGCAACGAAGTGCTGCTGGCGCGTTACGCGCTCTGCACCGCCCTCGACGAGGCCGTGCTCAGCAC
GCCGTGGGGCAGCACCAGCGACTGGGGCAAACAGAGCCTGCTGATCACCGTGCACAACGAAGCCTGGGGC
GGCGAAAAGGTCTTTCAGCTGCTCGACCACTGCCTGCAAAGCCCACGGGAACGCCTGTACCTGCTGGAGC
TTTTGTACTTGTGTCTGTGCCTGGGTTTCGAGGGTCGCTACCGCGTGATGAACGACGGTCGCAGCCAGCT
CGAAGCCCTGCGTGAGCGCACCGCCGCAGCGATTCGCAGTGCCCGTGGCGAGCATGAGCGCGAGCTGTCG
CCGCATTGGCGCGGCGTGACCGTGGCGCGCGATCGCCTGGCGCAGTTCATGCCGCCGTGGATCGCCGTGG
CCATCGGTCTCGCGCTGTTGCTGGCCTTGCTGTTCGGTTTGCGCCTGAAGCTGGCTGCGGATGCGGAGCC
GGTGTTCAAGAACATTCACGCCCTGGGCGAGATCCCGGTGCAGGCCATCGACCGGCCGGTGGCGCAGCCC
AAAGTCATCGAACGACCCCGCCTGGCGGGCTTTTTGGCCGAAGACATCAAGGCCGGCCGCGTCGCGGTGG
AAGACAAGGTCGACCGTTCCGTGGTGACGATCAAGGGTGACGAGCTGTTCGCCTCGGCCAGCGCGAGCAT
CGTCGACAACTACCAGCCGTTGATGCTGCGCATTGCCGACGCCATCCGCAAGGTCAAGGGCCAGGTGCGG
GTTACCGGCCACAGCGACAACCGCCCGATTGCCACGCTGCGCTTCCCGTCCAACTGGGCGTTGTCCGAAG
CGCGGGCCAAGTCGGTGCTGGAGATTCTCGCCGCCAAGACCGGCCAGGCCGAGCGCTTCAGCGCCGAAGG
CCGCAGCGACACCGAACCGCTGGCGACCAACGCGACCGCAGAAGGCCGTGCCCGCAATCGCCGGGTTGAA
ATCACTGTATTGGCGGAGGGCGTCGAGTGA
 Primer design