SecReT6
Protein ID: 447919066
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20380
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4626947..4628281 [-]
Producthypothetical protein
NoteTssK
UniProt IDM4K4U7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-153, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|447919066|ref|YP_007399634.1| hypothetical protein H045_20380 [Pseudomonas poae RE*1-1-14]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLALGKLAIVSARGLLP
DGTPFNIPQDDLAPSPLNIDDNLRDGLVYLALPLKRAGARDTVEAGEALEAARYVSQVREVRDDNAPFEN
RTPVAVGARALRLLTAEDGISDYAAVGLVRIKEKRADRALVLDDTYIPPVLDVAASKPLSAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLIQHITQLSPLHPERFFSELVSLAGEFSTFATSG
RRPQEYPHYQHDDLALSFAPVMAALREALSMLIDSKATPIPIVEKAYGVHVAMLADKTLLESASFILVVR
ADVPGETLRARFGQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSEHWQQLGN
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4628281-4626947 Pseudomonas poae RE*1-1-14, complete genome
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATCGGAACGCAGCACTTCCAGCAGCATG
ACCGTTACCTCGAGAACCTGATTGATGCCCGCAGTCGCCCGCTGTCTGCCGGCGCCTGGGGCTTTTCCGA
GCTGCTGATCGACCAGGGCCTGCTGGCCCTGGGCAAGCTGGCGATTGTCTCGGCGCGGGGCCTGTTGCCC
GATGGCACGCCATTCAATATTCCCCAGGACGACCTGGCGCCGAGCCCGCTGAACATTGACGACAACCTGC
GCGACGGCCTGGTGTACCTGGCCTTGCCGCTCAAGCGTGCGGGTGCGCGGGACACGGTGGAGGCAGGCGA
AGCGCTGGAAGCGGCGCGTTACGTGAGCCAGGTGCGCGAAGTGCGCGACGATAACGCACCGTTCGAAAAC
CGCACCCCCGTGGCCGTAGGCGCGCGTGCGTTGCGCCTGCTCACCGCCGAGGATGGCATCAGCGACTACG
CCGCCGTGGGCCTGGTGCGCATCAAGGAAAAACGCGCCGACCGCGCCTTGGTACTCGACGACACTTACAT
CCCGCCGGTGCTGGACGTGGCCGCCAGCAAACCGCTGAGCGCGTTTCGCAGTGAATTGCTCGGCCTGCTG
CACCAGCGCGGCGAAGCCCTGGCCGGTCGCGTGGTGGCTTCGGGCGCTGGCGGTGCCTCGGAGATTGCCG
ATTTCATGCTGCTGCAACTGGTCAACCGTGCGCAGCCGCTGATCCAGCACATCACCCAACTGAGCCCGCT
GCACCCGGAGCGTTTCTTCAGCGAACTGGTGAGCCTGGCCGGTGAGTTCTCTACCTTTGCCACGTCGGGT
CGACGCCCCCAGGAATACCCACACTACCAGCACGACGACCTGGCCCTGAGCTTCGCTCCGGTGATGGCGG
CGCTGCGTGAAGCGCTGTCGATGCTGATCGACAGCAAGGCCACGCCGATCCCGATTGTGGAGAAAGCCTA
TGGTGTGCACGTCGCCATGCTGGCGGACAAGACCCTGCTCGAGAGCGCCAGTTTCATCCTCGTGGTGCGC
GCCGATGTGCCCGGCGAAACCCTGCGCGCGCGCTTCGGCCAGCAGAGCAAGGTCGGTTCGGTGGAGCACA
TCCGCGATTTGGTCAACCTGCAATTGCCGGGCATCGGCCTGTTGCCCCTGCCGGTCGCGCCGCGCCAATT
GCCGTACCACGCAGGCTCCACCTACTACGAGTTGGACCGAGGCAGCGAACACTGGCAGCAACTGGGTAAT
TCCGGTGGGTTCGCTTTCCATATCGCCGGGCAGTTCCCGGGCTTGAACCTGGCCTTCTGGGCGATTCGAG
GATAA
 Primer design