SecReT6
Protein ID: 447919067
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20385
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4628300..4628809 [-]
Producttype VI secretion lipoprotein TssJ1
NoteTssJ
UniProt IDM4K576
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-39, Aligned region: 12..154
Lambda_Bor [PF06291], Evalue: 0.0036, Aligned region: 4..43
Protein Sequence: 169 a.a.     [Download]
>gi|447919067|ref|YP_007399635.1| type VI secretion lipoprotein TssJ1 [Pseudomonas poae RE*1-1-14]
MIFRFLLAAATALLLTACAQHAAKPESAAEADANSAAITLHFHAIAGLNPGANGQAAPVRVRIFELKNAA
TFARSDYFALADRAQSTLGLDLLDQDEVMVQPGQQLSIRRDLDPATRQVGLLVGYRELDRAQWRAVVNVP
PRQNTEHQISLDVRAVRADVVAPPSSPAQ
 
Nucleotide Sequence: 510 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4628809-4628300 Pseudomonas poae RE*1-1-14, complete genome
ATGATTTTCAGGTTTTTACTCGCAGCCGCCACCGCGCTGCTGCTGACGGCGTGTGCACAGCATGCGGCCA
AGCCCGAAAGCGCGGCTGAAGCCGACGCGAACAGCGCTGCCATCACATTGCATTTTCACGCCATTGCCGG
GCTCAACCCCGGTGCCAACGGCCAGGCCGCGCCGGTGCGGGTGCGCATTTTCGAACTGAAAAACGCCGCC
ACCTTCGCCCGCTCCGACTACTTCGCCCTGGCCGACCGCGCGCAGTCCACCCTCGGTCTCGACCTGCTGG
ACCAGGACGAAGTGATGGTCCAGCCCGGCCAGCAACTGAGCATCCGGCGCGACCTCGACCCTGCCACGCG
CCAGGTCGGCCTGCTGGTGGGCTATCGCGAGCTGGACCGCGCGCAATGGCGCGCGGTGGTCAACGTGCCG
CCGCGTCAGAACACCGAACACCAGATCAGCCTCGATGTTCGCGCCGTGCGCGCCGATGTCGTGGCTCCCC
CCTCCAGCCCTGCCCAATAA
 Primer design