SecReT6
Protein ID: 447919068
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20390
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4628864..4630087 [-]
Producttype VI secretion protein Fha1
NoteFha
UniProt IDM4KBP2
KEGG IDppz:H045_20390
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.40E-16, Aligned region: 3..70
Protein Sequence: 407 a.a.     [Download]
>gi|447919068|ref|YP_007399636.1| type VI secretion protein Fha1 [Pseudomonas poae RE*1-1-14]
MAIGRSSENDWVLPDPERLVSSQHCVIQYKDGRYYLTDNSTNGVELVNAGIRMRRGNSEPLQDGELIRIG
DYEIQARIDFTVQTIDSQAFAGDSPNSFEALMGAVANTPQATPAIAPQFQGASSMDTLPDLFDFLGPAAV
PPPTVADHVPSEQHDFRPPAPVAAPIVETPGASAAVIPEDWDLLGDAPPPPAPVIAAPPVVEPALPVVSA
QPQPDLLQAFLRGAGLDQLRLDNADACAQMESIGRSYRLMVEGLIDVLRARASLKGEFRMQQTMIQPAEN
NPLKFAPNADEALLLLLRHGNQAFMAPDVAVRESFDDLRAHQLAVMAGVEAAIKHLLARFEPAQLEARMG
KPGGLSSLFHGSRQAQYWQQFTELYSNISREAQEDFQDLFGREFSRAYEEHSARQRR
 
Nucleotide Sequence: 1224 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c4630087-4628864 Pseudomonas poae RE*1-1-14, complete genome
ATGGCGATCGGCCGCAGTTCGGAAAACGACTGGGTATTGCCCGATCCAGAGCGTCTGGTCTCTTCACAAC
ATTGCGTTATTCAATACAAGGATGGCCGTTATTATTTAACGGATAACAGCACCAATGGCGTGGAATTGGT
TAACGCCGGTATTCGCATGCGCCGGGGTAACAGCGAGCCGTTACAGGACGGCGAGTTGATCCGCATCGGT
GATTACGAAATTCAGGCGCGCATCGATTTCACTGTGCAAACCATTGATAGCCAAGCCTTTGCCGGTGACT
CGCCGAACAGCTTCGAAGCGTTGATGGGCGCCGTTGCGAACACGCCCCAGGCCACGCCGGCGATTGCACC
GCAGTTCCAGGGTGCCTCGTCGATGGACACCCTGCCGGACCTGTTCGACTTTCTTGGCCCCGCCGCCGTG
CCGCCGCCGACCGTGGCAGATCATGTGCCGTCCGAACAGCACGATTTCCGCCCACCCGCGCCCGTCGCCG
CGCCGATTGTCGAAACGCCAGGAGCGTCAGCTGCGGTGATTCCCGAAGACTGGGACCTGCTCGGCGATGC
GCCACCGCCGCCCGCACCCGTCATCGCTGCGCCACCTGTGGTCGAGCCCGCGCTCCCCGTGGTCAGCGCC
CAGCCGCAACCGGACCTTTTGCAAGCCTTCCTGCGCGGCGCCGGCCTCGATCAGCTGCGCCTGGACAACG
CCGATGCCTGCGCCCAGATGGAAAGCATCGGCCGCAGCTACCGGCTGATGGTCGAAGGCCTGATCGATGT
GTTGCGTGCCCGCGCCAGCCTCAAAGGCGAGTTCCGCATGCAACAGACCATGATCCAGCCCGCCGAAAAC
AATCCGTTGAAATTCGCCCCGAATGCCGACGAAGCGTTACTGCTGTTGCTGCGTCATGGCAACCAAGCGT
TCATGGCACCGGATGTGGCCGTGCGCGAGAGTTTCGATGACCTGCGCGCGCACCAGCTGGCGGTGATGGC
CGGCGTGGAAGCGGCGATCAAGCACCTGCTGGCGCGCTTTGAGCCGGCGCAGCTGGAAGCACGCATGGGC
AAGCCTGGCGGGCTGTCGAGTCTTTTCCACGGCTCGCGTCAGGCCCAGTACTGGCAACAGTTCACCGAGC
TTTACAGCAACATTTCCCGCGAGGCCCAGGAAGATTTCCAGGACCTGTTCGGCCGCGAGTTTAGCCGAGC
CTACGAAGAGCACAGTGCACGACAGCGTCGCTGA
 Primer design