SecReT6
Protein ID: 447919069
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20395
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4630563..4631582 [+]
Producttype VI secretion protein TssA1
NoteTssA
UniProt IDM4K6I8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.40E-19, Aligned region: 52..112
Protein Sequence: 339 a.a.     [Download]
>gi|447919069|ref|YP_007399637.1| type VI secretion protein TssA1 [Pseudomonas poae RE*1-1-14]
MDVPLLLTAVSANSPCGEDMEYDAQFLQLERDAKGQPERSMGDSILPAEPPDWRSIQQQSLDLLQRSKDL
RITHFLLQSTLALQGVAGLADVLMLIDALLRQYWAELHPRLDADDDNDPTVRINALSGLASDTTIRLLRE
SILTRSRTFGPVSLRAALNASGLLSFPDEALGAQQLNAAFLDSDPDQLQATRDALSAARAACEAIEQQVN
DQVGSAQGVELSALKQPLKQALHLLNQAVPGTDSSREPEAVSDDNAPWVDFAAAPAAPRPAGDIASRDDV
LRSLDKILAYYTRHEPSSPLPVLLNRAKNLVHADFAAIVRNLIPDGMSQFENLRGPDGE
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4630563-4631582 Pseudomonas poae RE*1-1-14, complete genome
GTGGATGTGCCGTTGCTGCTCACCGCCGTTTCCGCGAACTCGCCATGTGGCGAAGACATGGAATATGACG
CGCAATTTCTCCAACTGGAACGTGATGCCAAGGGCCAGCCCGAGCGCAGCATGGGCGACTCCATTCTGCC
CGCCGAACCGCCGGATTGGCGCAGCATCCAGCAGCAAAGCCTCGACTTGCTGCAGCGCAGCAAAGACCTG
CGCATCACCCACTTTCTGCTGCAAAGCACCCTCGCCCTCCAGGGTGTCGCGGGGCTGGCCGACGTTCTCA
TGCTGATCGATGCGCTGCTGCGCCAATACTGGGCCGAGCTGCACCCGCGCCTGGATGCCGACGACGACAA
CGACCCAACCGTGCGCATCAACGCCCTTTCCGGCCTGGCCAGCGACACCACCATCCGCCTGCTGCGCGAA
AGCATTCTCACGCGCTCGCGCACCTTCGGCCCGGTGAGCCTGCGCGCCGCGCTCAATGCCAGCGGGCTGT
TGAGCTTTCCTGATGAAGCACTCGGCGCGCAGCAACTCAACGCCGCGTTCCTCGACAGCGATCCCGACCA
GTTGCAAGCCACCCGCGACGCCCTCAGCGCGGCACGTGCAGCCTGCGAAGCCATCGAACAACAGGTCAAC
GACCAGGTCGGTTCCGCCCAGGGCGTGGAACTCAGCGCCTTGAAGCAGCCGCTTAAACAGGCGTTGCACC
TGCTCAATCAAGCGGTGCCCGGCACCGACAGCAGCCGCGAACCCGAGGCCGTCAGTGACGACAATGCCCC
CTGGGTCGACTTCGCCGCAGCCCCCGCCGCACCGCGTCCGGCTGGCGATATCGCCAGCCGCGATGACGTG
CTGCGCAGCCTCGACAAGATCCTTGCTTATTACACCCGGCACGAACCTTCAAGCCCGTTGCCGGTGCTGT
TGAACCGCGCGAAGAATCTGGTGCACGCCGATTTCGCGGCCATCGTGCGCAATCTGATTCCCGACGGCAT
GTCCCAATTTGAAAACCTGCGCGGCCCGGACGGCGAGTAA
 Primer design