SecReT6
Protein ID: 447919070
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20400
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4631637..4632143 [+]
Producthypothetical protein
NoteTssB
UniProt IDM4K902
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.10E-59, Aligned region: 10..163
Protein Sequence: 168 a.a.     [Download]
>gi|447919070|ref|YP_007399638.1| hypothetical protein H045_20400 [Pseudomonas poae RE*1-1-14]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLAAVADRKFLEVDADNFD
SRLKAMQPRVAFHIPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPAGDQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4631637-4632143 Pseudomonas poae RE*1-1-14, complete genome
GTGGCGAAGCAAAGTTCTCAGAAGTTCATCGCGCGCAACCGCGCGCCTCGGGTGCAGATCGAGTACGACG
TCGAGCTTTACGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTGATGGGCGTGATGGCCGACCTCGCCGG
CAAGCCTGCCGAGCCTCTGGCGGCGGTCGCCGACCGCAAGTTCCTCGAAGTGGACGCCGACAACTTCGAC
TCGCGTCTCAAGGCCATGCAGCCGCGCGTGGCGTTCCATATCCCCAACGAATTGACCGGCGAAGGCAACC
TGAGCCTGGACATCACCTTCGAAAGCATGGACGACTTCAGCCCCGCCGCCGTGGCGCGCAAGGTCGACTC
GCTGAACCAACTGCTCGAAGCCCGCACCCAACTGGCCAACCTGCTGACCTACATGGACGGCAAGACCGGC
GCTGAAGAAATCATCATGAAGGCGATCAAGGACCCGGCACTGCTCCAGGCACTTGCCAGCGCGCCGAAGC
CTGCAGGGGATCAGTAA
 Primer design