SecReT6
Protein ID: 447919071
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20405
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4632146..4633642 [+]
Producttype VI secretion protein TssC1
NoteTssC
UniProt IDM4K4V2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-196, Aligned region: 67..493
BMFP [PF04380], Evalue: 0.0011, Aligned region: 21..79
Protein Sequence: 498 a.a.     [Download]
>gi|447919071|ref|YP_007399639.1| type VI secretion protein TssC1 [Pseudomonas poae RE*1-1-14]
MTDTTVREGALNLGATEETSEFASLLMQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIESI
IAAIDAKLTAQVNQIIHHQDFQQLESAWRGLHYLVNNTESDEQLKIRVLNISKPELHKTLKKFKGTAWDQ
SPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWA
NAAYAMAVNINRSFKHYGWCSRIRGIESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVIVEEVEGNPGYYNSKFYLRPHYQLEGLTVSLRLVS
KLPSAKSA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4632146-4633642 Pseudomonas poae RE*1-1-14, complete genome
ATGACCGACACTACCGTTCGCGAAGGCGCGCTGAATCTGGGCGCCACCGAAGAAACCAGCGAGTTCGCAT
CCCTGCTGATGCAGGAATTCAAGCCCAAGACCGAGCGTGCCCGCGAAGCCGTGGAAACCGCCGTGCGCAC
CCTGGCCGAACAGGCCCTGGCGCAAACCGATCTGGTGTCCAATGACGCGATCAAGTCGATCGAATCGATC
ATCGCCGCCATCGACGCCAAGCTCACCGCCCAGGTCAACCAGATCATCCACCACCAGGACTTCCAGCAAC
TGGAAAGCGCCTGGCGTGGCCTGCACTACCTGGTCAACAACACCGAGAGCGATGAGCAGCTGAAAATTCG
CGTGCTCAACATCTCCAAGCCCGAACTGCACAAGACCCTGAAGAAATTCAAGGGCACCGCGTGGGACCAG
AGCCCGATCTTCAAGAAGATGTATGAAGAAGAATACGGTCAGTTCGGCGGCGAACCTTACGGCTGTCTGG
TGGGCGACTACTACTTCGATCAGTCGCCACCGGACGTGGAACTGCTGGGCGAGCTGTCGAAAGTCTGCGC
TGCCATGCACTCGCCGTTCATCGCTGCGGCCTCGCCGACCGTGATGGGCATGGGCTCGTGGCAGGAGCTG
TCGAACCCGCGTGATCTGACCAAGATCTTCACCACTCCGGAATACGCCGGCTGGCGCTCGCTGCGTGAAT
CGGAAGACTCGCGCTACATCGGCCTGACCATGCCGCGCTTCCTCGCGCGCCTGCCGTACGGCGCCAAGAC
CGACCCGGTGGAGGCGTTCGCCTTCGAAGAAAACACCGACGGCGCGGACAGCTCCAAGTACACTTGGGCC
AACGCCGCGTACGCGATGGCGGTGAACATCAACCGTTCGTTCAAACACTACGGCTGGTGCTCGCGCATCC
GTGGTATCGAGTCCGGCGGCGAAGTGGAAAACCTGCCGGCGCACACGTTCCCGACCGATGACGGCGGCGT
GGACATGAAGTGCCCGACCGAAATCGCCATCAGCGACCGCCGTGAAGCGGAGCTGGCGAAAAACGGTTTC
ATGCCGCTGCTGCACAAGAAAAACACCGACTTCGCCGCGTTCATCGGCGCCCAGTCATTGCAGAAGCCAG
CCGAATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCTGCGCGCCTGCCGTACCTGTTCGCCAC
CTGCCGTTTCGCGCACTACTTGAAGTGCATCGTTCGCGACAAGATCGGTTCCTTCAAAGAGAAGGACGAG
ATGCAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTCGACGGCGACCCGGCGCACTCCACCGAAACCA
CCAAGGCCCAGCACCCATTGGCTGCCGCCGAAGTGATCGTGGAAGAAGTGGAAGGCAACCCGGGGTACTA
CAACTCCAAGTTCTACCTGCGCCCGCACTACCAGCTTGAAGGGCTGACGGTGTCGTTGCGTCTGGTCTCG
AAGCTGCCTTCGGCGAAAAGCGCGTAA
 Primer design