SecReT6
Protein ID: 447919072
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20410
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4633815..4634303 [+]
Producttype VI secretion system effector Hcp1
NoteTssD
UniProt IDM4K581
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-45, Aligned region: 6..136
Protein Sequence: 162 a.a.     [Download]
>gi|447919072|ref|YP_007399640.1| type VI secretion system effector Hcp1 [Pseudomonas poae RE*1-1-14]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMAQSGNMHVGGGGGAGKVNIQDLSLTKYVDKASPNLM
MHCASGKHIDKVKLTVRKAGGESQVEYMVINLEEVLVTSLSTGGSGSDDRLTENVTLNFAQVLVDYQPQK
ADGTKDGGPIKFGWNIRSNTKR
 
Nucleotide Sequence: 489 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4633815-4634303 Pseudomonas poae RE*1-1-14, complete genome
ATGGCTGTTGATATTTTCATCAAGATCGGCGACATCAAGGGCGAGTCCATGGACAAGGCCCACAAGGACG
AAATCGACGTGCTGAACTGGAGCTGGGGCATGGCCCAGTCCGGCAACATGCACGTGGGCGGTGGTGGCGG
CGCGGGCAAGGTGAATATCCAGGACCTGTCGCTGACCAAGTACGTCGACAAGGCCTCGCCCAACCTGATG
ATGCACTGCGCCAGCGGCAAGCACATCGACAAGGTCAAGCTGACCGTGCGCAAGGCCGGTGGTGAAAGCC
AGGTCGAGTACATGGTGATCAACCTGGAAGAAGTGCTGGTCACGTCCCTGAGCACCGGCGGTTCGGGCAG
CGATGATCGCCTGACCGAGAACGTCACGCTTAACTTCGCCCAGGTGCTGGTCGACTACCAGCCGCAGAAA
GCCGACGGCACCAAAGACGGCGGCCCGATCAAGTTCGGCTGGAACATCCGGTCCAACACCAAGCGTTGA
 Primer design