SecReT6
Protein ID: 447919075
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20425
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4635258..4635773 [+]
Producthypothetical protein
NoteTssE
UniProt IDM4K905
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-23, Aligned region: 37..146
Protein Sequence: 171 a.a.     [Download]
>gi|447919075|ref|YP_007399643.1| hypothetical protein H045_20425 [Pseudomonas poae RE*1-1-14]
MVTEIAPRDRLQPSLLDRLTDDDPTNPKESADKRVLSLTQLKASVLRDLAWLLNTTSLLDADATLHTPAG
TSVINYGLPALAGNSVSSVDIKALEALIYQAIATFEPRILRHTLRVKARVGQGEMNHNALSFEIEGDLWA
QPVPLRLLLQTDLDLESGHVRVVNADQRRRP
 
Nucleotide Sequence: 516 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4635258-4635773 Pseudomonas poae RE*1-1-14, complete genome
GTGGTAACCGAAATCGCCCCGCGCGACCGTCTGCAACCGTCCCTGCTGGACCGGCTGACCGACGACGACC
CGACCAACCCCAAGGAGAGCGCTGACAAACGCGTGCTGTCCCTGACCCAATTGAAAGCCTCGGTGCTGCG
CGACCTGGCGTGGCTGCTCAACACCACCTCGCTGCTCGATGCCGATGCCACCCTGCACACGCCGGCCGGC
ACGTCCGTGATCAATTACGGCCTGCCGGCACTCGCGGGCAACAGCGTTTCCAGCGTGGATATCAAAGCGC
TCGAAGCCTTGATCTACCAGGCCATCGCCACTTTTGAACCGCGCATTTTGCGCCACACCCTGCGGGTCAA
GGCCCGCGTCGGCCAGGGCGAGATGAATCACAACGCCCTGAGTTTCGAGATCGAAGGCGACCTGTGGGCG
CAGCCGGTGCCGTTGCGCCTGCTGCTGCAAACCGATCTGGACCTGGAGTCCGGCCATGTGCGCGTGGTCA
ACGCCGATCAGCGGAGACGCCCATGA
 Primer design