SecReT6
Protein ID: 447919076
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20430
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4635770..4637629 [+]
Producttype VI secretion protein TssF
NoteTssF
UniProt IDM4K4V5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-217, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|447919076|ref|YP_007399644.1| type VI secretion protein TssF [Pseudomonas poae RE*1-1-14]
MNPRLLELYNQELHHVRESAAEFAREYPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQTDPDEGSLASGFPLPRDTVLRAALGRETQTCCEYRTAHPVTLWP
LQVRNAEYFGNPAAVLGRLAASEPKAKAGLRLTLRTGAELPFNSLDLDNLPLYLSGADEQPFRLYEQLLG
NACAVFARKPGGDWVERLPKDALRSRGFDDADAAMPVVARAFQGYRLLQEYFALPHRFLFVEFAELSRAV
KRCDGQELELIVLFDRHEPSLEGSVGAAQFLPFCTPAINLFPKRVDRIHLSDRVNEHHVIADRTRPMDFE
IHSLSGITGHGTGPEQPFLPFYAVRDPSRYGRDQAYYTVRREPRVLSSDQRRNGPRSTYVGSETFVSLVD
SRQAPYGHDLRQLGVTALCTNRDLPLFMSVGNGKTDFTLADSAPVLAVRCVAGPSRPRASHAHDAKAWRL
ISQLSLNYLSLSEQGQGAGALRELLRLYGDSNDAALPLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRTTERGEIMRWKATPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4635770-4637629 Pseudomonas poae RE*1-1-14, complete genome
ATGAACCCGCGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTTCGCGAAAGCGCCGCCGAGTTCG
CCAGGGAATACCCGAAGATCGCCAGTCGGCTGACATTGTCCGGCATGGACTGCGCCGACCCGTACGTCGA
ACGCCTGCTCGAAGGCTTTGCCTACCTCACGGCCCGCGTGCAGCTCAAGCTCGATGCCGAGTACCCGACC
TTCACCCATAACCTGTTGGAAATTGCCTACCCGCACTACCTGGCGCCGACCCCGTCGATGACCGTGGTGC
AATTGCAGACCGACCCGGATGAGGGCTCCCTGGCCAGTGGTTTCCCATTGCCGCGCGACACCGTACTGCG
CGCGGCCCTGGGCCGCGAAACCCAGACCTGCTGCGAGTACCGCACCGCGCACCCGGTGACGCTGTGGCCG
CTGCAGGTCCGCAACGCCGAATATTTCGGCAACCCCGCCGCCGTACTCGGCCGCCTGGCCGCCAGCGAGC
CGAAAGCCAAGGCCGGCCTGCGCCTGACCCTGCGCACCGGCGCCGAACTGCCGTTCAACAGCCTTGACCT
GGACAACCTGCCGCTGTACCTCAGCGGTGCCGACGAGCAACCCTTTCGCCTCTACGAACAATTGCTCGGC
AATGCCTGCGCCGTGTTTGCGCGCAAGCCGGGTGGCGACTGGGTCGAGCGTCTGCCCAAAGACGCGCTGC
GCTCGCGCGGCTTTGACGATGCCGACGCGGCAATGCCGGTGGTGGCGCGTGCGTTCCAGGGTTATCGCCT
GCTGCAGGAATACTTCGCCCTGCCCCACCGCTTTCTGTTCGTCGAATTCGCCGAGCTGAGCCGCGCAGTC
AAACGCTGCGACGGCCAAGAGCTGGAACTGATCGTGCTGTTCGACCGCCACGAGCCGAGCCTGGAAGGCA
GCGTCGGCGCGGCACAGTTCCTGCCGTTCTGCACGCCGGCGATCAACCTGTTCCCCAAGCGCGTGGACCG
CATTCACTTGTCCGACCGGGTCAACGAACACCATGTGATCGCCGACCGCACGCGGCCGATGGACTTCGAG
ATTCACTCTTTGAGCGGTATCACCGGCCACGGCACCGGGCCGGAGCAGCCGTTCCTGCCGTTTTACGCGG
TGCGCGATCCATCACGCTACGGCCGTGACCAGGCTTACTACACCGTGCGCCGCGAGCCCCGCGTGTTGTC
CAGCGACCAGCGCCGCAACGGCCCGCGCTCCACCTATGTGGGCAGCGAAACTTTCGTCAGCCTGGTGGAC
AGCCGCCAGGCGCCCTATGGCCATGACTTGCGCCAATTGGGCGTGACGGCGCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGAGCGTGGGCAACGGCAAGACCGATTTCACCCTGGCCGACAGCGCGCCGGTGTTGGC
TGTGCGTTGTGTGGCAGGGCCGAGCCGTCCGCGCGCCAGCCACGCCCACGATGCGAAGGCGTGGCGCTTG
ATCAGCCAGCTGTCGCTCAACTATTTGTCACTGAGCGAGCAAGGCCAGGGTGCCGGCGCCCTGCGTGAAC
TGCTGCGCCTGTATGGCGACAGCAACGATGCCGCCCTGCCCTTGCAGATCGAGGGCCTGCGCGAGGTCAG
CAGCAAAGCGGTGACCCGGCGCCTGCCGATGCCCGGCCCGATTGTGTTCGGGCGCGGCTTGGAGATCACC
CTCGAATTTGATGAAAACGCGTTTCGCGGCACCGGTGTGTTTCTGCTCGGTGCGGTGTTCGAACGCTTCC
TGGCACGCTACGTGTCGATCAACAGTTTTACCGAAACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCACGCCCGGACGGCGTCCGACCCTGTGA
 Primer design